DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drep3 and CIDEB

DIOPT Version :9

Sequence 1:NP_610722.2 Gene:Drep3 / 36292 FlyBaseID:FBgn0028407 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001305736.1 Gene:CIDEB / 27141 HGNCID:1977 Length:219 Species:Homo sapiens


Alignment Length:135 Identity:36/135 - (26%)
Similarity:55/135 - (40%) Gaps:30/135 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 TPTPSPTTADEDFAQLDNSKPFKIKDITRNIRKAVVATTLSELRTKV--SLKFERAQPAIHLDCD 162
            |..|.|            .:||::.|..|.|||.:.|.|..||..|.  :|........: |:.|
Human    29 TSAPPP------------QRPFRVCDHKRTIRKGLTAATRQELLAKALETLLLNGVLTLV-LEED 80

  Fly   163 GTEVDDEEYFSTLEPNAELIAVFPGEQW-------------RDPSDYNANLRRTSLDA--QRLRS 212
            ||.||.|::|..||.:..|:.:..|:.|             |:...::.::.|.:.|.  |..|.
Human    81 GTAVDSEDFFQLLEDDTCLMVLQSGQSWSPTRSGVLSYGLGRERPKHSKDIARFTFDVYKQNPRD 145

  Fly   213 LVSKL 217
            |...|
Human   146 LFGSL 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Drep3NP_610722.2 CIDE_N 119..192 CDD:119367 26/87 (30%)
CIDEBNP_001305736.1 CIDE_N_B 34..114 CDD:119370 27/92 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 60 1.000 Domainoid score I10585
eggNOG 1 0.900 - - E1_28MIP
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001779
OrthoInspector 1 1.000 - - mtm8628
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.770

Return to query results.
Submit another query.