DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drep3 and Cidec

DIOPT Version :9

Sequence 1:NP_610722.2 Gene:Drep3 / 36292 FlyBaseID:FBgn0028407 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001359193.1 Gene:Cidec / 14311 MGIID:95585 Length:249 Species:Mus musculus


Alignment Length:198 Identity:47/198 - (23%)
Similarity:89/198 - (44%) Gaps:31/198 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 LDDAADSITL--ELALSPH-SSATPTPSPTTADEDFAQLDNSKPFKIKDITRNIRKAVVATTLSE 141
            :|.|..|::|  ..:||.| :.:|...:.....:...:...::|.::....|.:||.::|.:|.:
Mouse    11 MDYAMKSLSLLYPRSLSRHVAVSTAVVTQQLVSKPSRETPRARPCRVSTADRKVRKGIMAHSLED 75

  Fly   142 LRTKVS--LKFERAQPAIHLDCDGTEVDDEEYFSTLEPNAELIAVFPGEQWRDPSDYNANLRRTS 204
            |..||.  ||.:....::.|:.|||.|:.||||..|..:...:.:..|::|:.||:......:.:
Mouse    76 LLNKVQDILKLKDKPFSLVLEEDGTIVETEEYFQALAKDTMFMVLLKGQKWKPPSEQRKKRAQLA 140

  Fly   205 LDAQRLRSL-VSKLQPNYMNDDDLDKLSNMDPNSLVDITGREPKD-----NEYSARSDAARLSTE 263
            |..:..:.: |:::      ..||.||:              |:|     |..:...|...||.:
Mouse   141 LSQKPTKKIDVARV------TFDLYKLN--------------PQDFIGCLNVKATLYDTYSLSYD 185

  Fly   264 LSC 266
            |.|
Mouse   186 LHC 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Drep3NP_610722.2 CIDE_N 119..192 CDD:119367 23/74 (31%)
CidecNP_001359193.1 CIDE_N 51..130 CDD:383014 23/78 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28MIP
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I5449
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001779
OrthoInspector 1 1.000 - - mtm8861
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.820

Return to query results.
Submit another query.