DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drep3 and Dffa

DIOPT Version :9

Sequence 1:NP_610722.2 Gene:Drep3 / 36292 FlyBaseID:FBgn0028407 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001020467.1 Gene:Dffa / 13347 MGIID:1196227 Length:331 Species:Mus musculus


Alignment Length:192 Identity:54/192 - (28%)
Similarity:79/192 - (41%) Gaps:43/192 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 LALSPHSSATPTPSPTTADEDFAQLDNSKPFKIKDITRNIRK---AVVATTLSELRTKVS--LKF 150
            :.||..:||   |.|          |:.:|.|...:.||..:   .|.|::|.|||:|..  |..
Mouse     1 MELSRGASA---PDP----------DDVRPLKPCLLRRNHSRDQHGVAASSLEELRSKACELLAI 52

  Fly   151 ERAQPAIHLDC--DGTEVDDEEYFSTLEPNAELIAVFPGEQW--RDPSDYNANLRRTSLDAQRLR 211
            :::...|.|..  |||.|||::||..|..|.:.:|:...|:|  .|.....|.:.:.|.:|....
Mouse    53 DKSLTPITLVLAEDGTIVDDDDYFLCLPSNTKFVALACNEKWIYNDSDGGTAWVSQESFEADEPD 117

  Fly   212 SLVSKLQPNYMND--DDLDK---LSNMDPNSLVDITGREPKDNEYSARSDAARLSTEL--SC 266
            |.......|....  :||..   ||..|..:|:||              ..|.|:.||  ||
Mouse   118 SRAGVKWKNVARQLKEDLSSIILLSEEDLQALIDI--------------PCAELAQELCQSC 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Drep3NP_610722.2 CIDE_N 119..192 CDD:119367 27/81 (33%)
DffaNP_001020467.1 CIDE_N_ICAD 17..96 CDD:119369 27/78 (35%)
DFF-C 100..263 CDD:286165 19/80 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 306..331
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849544
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.