DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drep3 and Cideb

DIOPT Version :9

Sequence 1:NP_610722.2 Gene:Drep3 / 36292 FlyBaseID:FBgn0028407 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_034024.2 Gene:Cideb / 12684 MGIID:1270844 Length:219 Species:Mus musculus


Alignment Length:155 Identity:40/155 - (25%)
Similarity:67/155 - (43%) Gaps:30/155 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 DGLDDAADSITLELALSPHSSATPTPSPTTADEDFAQLDNSKPFKIKDITRNIRKAVVATTLSEL 142
            :||..:..:::.||:....:||.|.               .:||::.|..|.:||.:.|.:|.||
Mouse    10 NGLLRSVSTVSSELSRRVWNSAPPP---------------QRPFRVCDHKRTVRKGLTAASLQEL 59

  Fly   143 RTKV-SLKFERAQPAIHLDCDGTEVDDEEYFSTLEPNAELIAVFPGEQW------------RDPS 194
            ..|| .....|....:.|:.|||.||.|::|..||.:..|:.:..|:.|            |:..
Mouse    60 LDKVLETLLLRGVLTLVLEEDGTAVDSEDFFQLLEDDTCLMVLEQGQSWSPKSGMLSYGLGREKP 124

  Fly   195 DYNANLRRTSLDA--QRLRSLVSKL 217
            .::.::.|.:.|.  |..|.|...|
Mouse   125 KHSKDIARITFDVYKQNPRDLFGSL 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Drep3NP_610722.2 CIDE_N 119..192 CDD:119367 26/85 (31%)
CidebNP_034024.2 CIDE_N_B 34..114 CDD:119370 26/94 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 59 1.000 Domainoid score I10612
eggNOG 1 0.900 - - E1_28MIP
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I5449
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001779
OrthoInspector 1 1.000 - - mtm8861
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.820

Return to query results.
Submit another query.