DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drep3 and CIDEA

DIOPT Version :9

Sequence 1:NP_610722.2 Gene:Drep3 / 36292 FlyBaseID:FBgn0028407 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001305312.1 Gene:CIDEA / 1149 HGNCID:1976 Length:253 Species:Homo sapiens


Alignment Length:103 Identity:30/103 - (29%)
Similarity:53/103 - (51%) Gaps:10/103 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 SKPFKIKDITRNIRKAVVATTLSELRTKV--SLKFERAQPAIHLDCDGTEVDDEEYFSTLEPNAE 180
            ::||::.:..|:.|:.|:|::|.||.:|.  :|........:.|:.|||.||.||:|.||..|..
Human    68 ARPFRVSNHDRSSRRGVMASSLQELISKTLDALVIATGLVTLVLEEDGTVVDTEEFFQTLGDNTH 132

  Fly   181 LIAVFPGEQWRDPSDY--------NANLRRTSLDAQRL 210
            .:.:..|::|...|.:        .:.:.|.:.|..||
Human   133 FMILEKGQKWMPGSQHVPTCSPPKRSGIARVTFDLYRL 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Drep3NP_610722.2 CIDE_N 119..192 CDD:119367 25/74 (34%)
CIDEANP_001305312.1 CIDE_N_A 67..144 CDD:119372 25/75 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 60 1.000 Domainoid score I10585
eggNOG 1 0.900 - - E1_28MIP
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001779
OrthoInspector 1 1.000 - - mtm8628
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.770

Return to query results.
Submit another query.