DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drep1 and cidec

DIOPT Version :9

Sequence 1:NP_001260909.1 Gene:Drep1 / 36290 FlyBaseID:FBgn0024732 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001038512.1 Gene:cidec / 564304 ZFINID:ZDB-GENE-030131-4591 Length:239 Species:Danio rerio


Alignment Length:82 Identity:30/82 - (36%)
Similarity:50/82 - (60%) Gaps:3/82 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KPFKVKDVTRNIKKAVCASSLEEIRSKVAEKFE-KCDHLPTIHLDSDGTEIDDEEYFRTLDENTE 75
            :||:|.:..|:|||.:.|..||::..||.:.|. .|  :..:.||.|||.||.:::|:||.:||.
Zfish    38 RPFRVINSDRSIKKGIMADDLEDLHHKVMDVFHIHC--ISALVLDEDGTGIDTQDFFQTLKDNTV 100

  Fly    76 LVAVFPGEHWIDPTHYV 92
            |:.:..|:.|...|.::
Zfish   101 LMVLGKGQKWAPQTKHL 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Drep1NP_001260909.1 CAD 12..85 CDD:128562 28/73 (38%)
cidecNP_001038512.1 CIDE_N_FSP27 36..114 CDD:119371 29/77 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 58 1.000 Domainoid score I10758
eggNOG 1 0.900 - - E1_28MIP
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001779
OrthoInspector 1 1.000 - - mtm6534
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12306
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4920
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.