DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drep1 and cideb

DIOPT Version :9

Sequence 1:NP_001260909.1 Gene:Drep1 / 36290 FlyBaseID:FBgn0024732 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001243186.1 Gene:cideb / 553467 ZFINID:ZDB-GENE-080514-2 Length:208 Species:Danio rerio


Alignment Length:245 Identity:54/245 - (22%)
Similarity:96/245 - (39%) Gaps:64/245 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 METAANSGDS---------KKPFKVKDVTRNIKKAVCASSLEEIRSKVAEKFEKCDHLPTIHLDS 56
            |||.::...|         ::||:|....|.:||.:.|.:|||::.:..:.. ....:.|:..:.
Zfish     1 METTSSLFKSVSRRVWSPPQRPFRVCSWNREVKKGITAGTLEELKERAGQAL-LISKMLTLVCEE 64

  Fly    57 DGTEIDDEEYFRTLDENTELVAVFPGEHWIDPTHYVTITTPHGNEAGTGNGELNGGGEGDTTDAN 121
            ||||:|.:|:...|.:||..:.:.|.|.|          .||......||      ..||:....
Zfish    65 DGTEVDSDEFLIALPDNTVFMCLQPEEIW----------KPHPLHQRGGN------KPGDSKPRT 113

  Fly   122 NSESARI---------RQLVGQLQ-----NNLCNVSVMNDADLDSLSNMDPNSLVDITGKEFMEQ 172
            ..:.|:|         :.:.|.|.     ..|.:||    ||...|.           .|:|   
Zfish   114 GKDIAQITFDLYRTHPKDVFGSLNVKATYQGLYSVS----ADFQCLG-----------PKKF--- 160

  Fly   173 LKDAGRPLCAKRNAEDRLNLLKLLKAGAIFCSERYPEDAEAIDREIGRQL 222
            |::|.:.:....:|...|    |:.:.|:.  .|..:.|:.:..:..:|:
Zfish   161 LREALKMMSTLLHAAGHL----LISSAAVI--RRIIQGADMLQAQNNKQI 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Drep1NP_001260909.1 CAD 12..85 CDD:128562 22/72 (31%)
cidebNP_001243186.1 CIDE-N 20..93 CDD:280235 22/73 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001779
OrthoInspector 1 1.000 - - mtm6534
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12306
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4920
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.040

Return to query results.
Submit another query.