DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drep1 and Cidec

DIOPT Version :10

Sequence 1:NP_001260909.1 Gene:Drep1 / 36290 FlyBaseID:FBgn0024732 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001019504.2 Gene:Cidec / 500292 RGDID:1562113 Length:248 Species:Rattus norvegicus


Alignment Length:78 Identity:24/78 - (30%)
Similarity:44/78 - (56%) Gaps:0/78 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KPFKVKDVTRNIKKAVCASSLEEIRSKVAEKFEKCDHLPTIHLDSDGTEIDDEEYFRTLDENTEL 76
            :|.:|....|.::|.:.|.|||::..||.:..:..|...::.|:.|||.::.||||:.|..:|..
  Rat    53 RPCRVSTADRKVRKGIMAHSLEDLLGKVQDILKLKDKPFSLVLEEDGTIVETEEYFQALPRDTVF 117

  Fly    77 VAVFPGEHWIDPT 89
            :.:..|:.|..|:
  Rat   118 MVLQKGQKWKSPS 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Drep1NP_001260909.1 CAD 12..85 CDD:128562 22/72 (31%)
CidecNP_001019504.2 CIDE_N 51..130 CDD:470607 23/76 (30%)

Return to query results.
Submit another query.