DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drep1 and cideb

DIOPT Version :9

Sequence 1:NP_001260909.1 Gene:Drep1 / 36290 FlyBaseID:FBgn0024732 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001011434.1 Gene:cideb / 496919 XenbaseID:XB-GENE-964767 Length:219 Species:Xenopus tropicalis


Alignment Length:86 Identity:23/86 - (26%)
Similarity:52/86 - (60%) Gaps:3/86 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 METAANSGDSKKPFKVKDVTRNIKKAVCASSLEEIRSKVAEKFEKCDHLPTIHLDSDGTEIDDEE 65
            ::||  |...::||:|.:..|.:::.|.|.||.|:.::..:.. ....:.::.|:.|||::|.|:
 Frog    27 VKTA--SSPPQRPFRVCNHDRTVRRGVTAGSLRELIARAMDAL-FLSGVVSLVLEDDGTQLDRED 88

  Fly    66 YFRTLDENTELVAVFPGEHWI 86
            :|.||::.:.::.:..|:.|:
 Frog    89 FFETLEDGSVVMVLEKGQKWM 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Drep1NP_001260909.1 CAD 12..85 CDD:128562 19/72 (26%)
cidebNP_001011434.1 CIDE_N 34..114 CDD:383014 20/77 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001779
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12306
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.