DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drep1 and cidec

DIOPT Version :9

Sequence 1:NP_001260909.1 Gene:Drep1 / 36290 FlyBaseID:FBgn0024732 Length:306 Species:Drosophila melanogaster
Sequence 2:XP_012816408.1 Gene:cidec / 493464 XenbaseID:XB-GENE-964503 Length:248 Species:Xenopus tropicalis


Alignment Length:88 Identity:29/88 - (32%)
Similarity:56/88 - (63%) Gaps:6/88 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KPFKVKDVTRNIKKAVCASSLEEIRSKVAEKFEKCDHLPTIHLDSDGTEIDDEEYFRTLDENTEL 76
            :||:|.:..|:::|.:.|:|||::.:|..:.....:.: |:.||.|||.:|.||:||:||:....
 Frog    51 RPFRVCNSNRSLRKGIVANSLEDLINKTQDALLMLEAI-TLVLDEDGTCVDTEEFFRSLDDGAVF 114

  Fly    77 VAVFPGEHWIDPT----HYVTIT 95
            :|:..|:.| .||    :::::|
 Frog   115 MALAKGQKW-KPTENSGYHLSLT 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Drep1NP_001260909.1 CAD 12..85 CDD:128562 25/72 (35%)
cidecXP_012816408.1 CIDE_N 49..127 CDD:383014 27/77 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 57 1.000 Domainoid score I10717
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001779
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12306
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4920
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.040

Return to query results.
Submit another query.