DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drep1 and Cideb

DIOPT Version :9

Sequence 1:NP_001260909.1 Gene:Drep1 / 36290 FlyBaseID:FBgn0024732 Length:306 Species:Drosophila melanogaster
Sequence 2:XP_006252064.1 Gene:Cideb / 364388 RGDID:1310000 Length:264 Species:Rattus norvegicus


Alignment Length:75 Identity:25/75 - (33%)
Similarity:47/75 - (62%) Gaps:1/75 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KKPFKVKDVTRNIKKAVCASSLEEIRSKVAEKFEKCDHLPTIHLDSDGTEIDDEEYFRTLDENTE 75
            ::||:|.|..|.::|.:.|::.:|:..||.|.......| |:.|:.|||.::.|::|..|:::|.
  Rat    80 QRPFRVCDHKRTVRKGLTAATRQELLDKVVETLLLSGVL-TLVLEEDGTAVETEDFFELLEDDTC 143

  Fly    76 LVAVFPGEHW 85
            |:|:..|:.|
  Rat   144 LMALEQGQSW 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Drep1NP_001260909.1 CAD 12..85 CDD:128562 24/72 (33%)
CidebXP_006252064.1 CIDE_N_B 79..159 CDD:119370 25/75 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28MIP
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001779
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12306
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.870

Return to query results.
Submit another query.