DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drep1 and Drep3

DIOPT Version :10

Sequence 1:NP_001260909.1 Gene:Drep1 / 36290 FlyBaseID:FBgn0024732 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_610722.2 Gene:Drep3 / 36292 FlyBaseID:FBgn0028407 Length:266 Species:Drosophila melanogaster


Alignment Length:160 Identity:83/160 - (51%)
Similarity:103/160 - (64%) Gaps:30/160 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DSKKPFKVKDVTRNIKKAVCASSLEEIRSKVAEKFEKCDHLPTIHLDSDGTEIDDEEYFRTLDEN 73
            |:.||||:||:||||:|||.|::|.|:|:||:.|||:..  |.||||.||||:||||||.||:.|
  Fly   116 DNSKPFKIKDITRNIRKAVVATTLSELRTKVSLKFERAQ--PAIHLDCDGTEVDDEEYFSTLEPN 178

  Fly    74 TELVAVFPGEHWIDPTHYVTITTPHGNEAGTGNGELNGGGEGDTTDANNSESARIRQLVGQLQNN 138
            .||:||||||.|.||:.|              |..|.         ..:.::.|:|.||.:||.|
  Fly   179 AELIAVFPGEQWRDPSDY--------------NANLR---------RTSLDAQRLRSLVSKLQPN 220

  Fly   139 LCNVSVMNDADLDSLSNMDPNSLVDITGKE 168
                 .|||.|||.||||||||||||||:|
  Fly   221 -----YMNDDDLDKLSNMDPNSLVDITGRE 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Drep1NP_001260909.1 CAD 12..85 CDD:128562 48/72 (67%)
Drep3NP_610722.2 CIDE_N 119..192 CDD:119367 49/74 (66%)

Return to query results.
Submit another query.