DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drep1 and Cidea

DIOPT Version :9

Sequence 1:NP_001260909.1 Gene:Drep1 / 36290 FlyBaseID:FBgn0024732 Length:306 Species:Drosophila melanogaster
Sequence 2:XP_038952597.1 Gene:Cidea / 291541 RGDID:1305106 Length:258 Species:Rattus norvegicus


Alignment Length:85 Identity:31/85 - (36%)
Similarity:48/85 - (56%) Gaps:0/85 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KPFKVKDVTRNIKKAVCASSLEEIRSKVAEKFEKCDHLPTIHLDSDGTEIDDEEYFRTLDENTEL 76
            :||:|.:..|:.::.|.||||.|:.||..:.......|.|:.|:.|||.:|.||:|:||.:||..
  Rat    78 RPFRVSNHDRSSRRGVMASSLRELISKTLDVLVITTGLVTLVLEEDGTVVDTEEFFQTLRDNTHF 142

  Fly    77 VAVFPGEHWIDPTHYVTITT 96
            :.:..|:.|.....||...|
  Rat   143 MILEKGQKWTPGNKYVCTQT 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Drep1NP_001260909.1 CAD 12..85 CDD:128562 27/72 (38%)
CideaXP_038952597.1 CIDE_N_A 76..153 CDD:119372 28/74 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I11157
eggNOG 1 0.900 - - E1_28MIP
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001779
OrthoInspector 1 1.000 - - otm45574
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12306
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.870

Return to query results.
Submit another query.