DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drep1 and CIDEB

DIOPT Version :9

Sequence 1:NP_001260909.1 Gene:Drep1 / 36290 FlyBaseID:FBgn0024732 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001305736.1 Gene:CIDEB / 27141 HGNCID:1977 Length:219 Species:Homo sapiens


Alignment Length:91 Identity:28/91 - (30%)
Similarity:54/91 - (59%) Gaps:2/91 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KKPFKVKDVTRNIKKAVCASSLEEIRSKVAEKFEKCDHLPTIHLDSDGTEIDDEEYFRTLDENTE 75
            ::||:|.|..|.|:|.:.|::.:|:.:|..|.. ..:.:.|:.|:.|||.:|.|::|:.|:::|.
Human    35 QRPFRVCDHKRTIRKGLTAATRQELLAKALETL-LLNGVLTLVLEEDGTAVDSEDFFQLLEDDTC 98

  Fly    76 LVAVFPGEHWIDPTHYVTITTPHGNE 101
            |:.:..|:.| .||....::...|.|
Human    99 LMVLQSGQSW-SPTRSGVLSYGLGRE 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Drep1NP_001260909.1 CAD 12..85 CDD:128562 23/72 (32%)
CIDEBNP_001305736.1 CIDE_N_B 34..114 CDD:119370 26/80 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 60 1.000 Domainoid score I10585
eggNOG 1 0.900 - - E1_28MIP
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001779
OrthoInspector 1 1.000 - - mtm8628
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12306
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4920
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.