DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drep1 and CIDEB

DIOPT Version :10

Sequence 1:NP_001260909.1 Gene:Drep1 / 36290 FlyBaseID:FBgn0024732 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_055245.2 Gene:CIDEB / 27141 HGNCID:1977 Length:219 Species:Homo sapiens


Alignment Length:91 Identity:28/91 - (30%)
Similarity:54/91 - (59%) Gaps:2/91 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KKPFKVKDVTRNIKKAVCASSLEEIRSKVAEKFEKCDHLPTIHLDSDGTEIDDEEYFRTLDENTE 75
            ::||:|.|..|.|:|.:.|::.:|:.:|..|.. ..:.:.|:.|:.|||.:|.|::|:.|:::|.
Human    35 QRPFRVCDHKRTIRKGLTAATRQELLAKALETL-LLNGVLTLVLEEDGTAVDSEDFFQLLEDDTC 98

  Fly    76 LVAVFPGEHWIDPTHYVTITTPHGNE 101
            |:.:..|:.| .||....::...|.|
Human    99 LMVLQSGQSW-SPTRSGVLSYGLGRE 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Drep1NP_001260909.1 CAD 12..85 CDD:128562 23/72 (32%)
CIDEBNP_055245.2 CIDE_N_B 34..114 CDD:119370 26/80 (33%)

Return to query results.
Submit another query.