DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drep1 and CIDEA

DIOPT Version :9

Sequence 1:NP_001260909.1 Gene:Drep1 / 36290 FlyBaseID:FBgn0024732 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001305312.1 Gene:CIDEA / 1149 HGNCID:1976 Length:253 Species:Homo sapiens


Alignment Length:86 Identity:30/86 - (34%)
Similarity:52/86 - (60%) Gaps:0/86 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KPFKVKDVTRNIKKAVCASSLEEIRSKVAEKFEKCDHLPTIHLDSDGTEIDDEEYFRTLDENTEL 76
            :||:|.:..|:.::.|.||||:|:.||..:.......|.|:.|:.|||.:|.||:|:||.:||..
Human    69 RPFRVSNHDRSSRRGVMASSLQELISKTLDALVIATGLVTLVLEEDGTVVDTEEFFQTLGDNTHF 133

  Fly    77 VAVFPGEHWIDPTHYVTITTP 97
            :.:..|:.|:..:.:|...:|
Human   134 MILEKGQKWMPGSQHVPTCSP 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Drep1NP_001260909.1 CAD 12..85 CDD:128562 27/72 (38%)
CIDEANP_001305312.1 CIDE_N_A 67..144 CDD:119372 28/74 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 60 1.000 Domainoid score I10585
eggNOG 1 0.900 - - E1_28MIP
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001779
OrthoInspector 1 1.000 - - mtm8628
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12306
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4920
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.