DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 128up and AT1G72660

DIOPT Version :9

Sequence 1:NP_536733.1 Gene:128up / 36288 FlyBaseID:FBgn0010339 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_001031270.1 Gene:AT1G72660 / 843598 AraportID:AT1G72660 Length:399 Species:Arabidopsis thaliana


Alignment Length:366 Identity:208/366 - (56%)
Similarity:268/366 - (73%) Gaps:3/366 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ILEKISAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGGGTGEAGFEVAKTGDARVG 68
            |:|:|..||:|||||||||||..|||.||||:||||.:|:.|..|..|.|: ||||.|.|..||.
plant     3 IVERIKEIEAEMARTQKNKATEYHLGQLKAKIAKLRTQLLEPPKGSSGGGD-GFEVTKYGHGRVA 66

  Fly    69 FVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLTTVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGR 133
            .:|||||||||||:.|.|.:||.|:|||||||.:||.|.|...||||||||||||||.:||||||
plant    67 LIGFPSVGKSTLLTMLTGTHSEAASYEFTTLTCIPGVIHYNDTKIQLLDLPGIIEGASEGKGRGR 131

  Fly   134 QVIAVARTCNLIFMVLDCLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNSMVPQS 198
            ||||||::.:|:.||||..|..||:::|..|||..|:||||:||.||:|:|..|||:.|:..|.:
plant   132 QVIAVAKSSDLVLMVLDASKSEGHRQILTKELEAVGLRLNKRPPQIYFKKKKTGGISFNTTTPLT 196

  Fly   199 ELDTDLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKIDQISIEELDVIYK 263
            .:|..|...||.|||||||::..|.|||.||.|||:||||.||.|:|:.||||.:.|:::|.:.:
plant   197 RIDEKLCYQILHEYKIHNAEVLFREDATVDDFIDVVEGNRKYIKCVYVYNKIDVVGIDDVDRLAR 261

  Fly   264 IPHCVPISAHHHWNFDDLLELMWEYLRLQRIYTKPKGQLPDYNSPVVLHNER--TSIEDFCNKLH 326
            .|:.:.||.:...|.|.||..||:.:.|.|:|:||:.|.||::.|.||..:|  .::|||||::|
plant   262 QPNSIVISCNLKLNLDRLLARMWDEMGLVRVYSKPQSQQPDFDEPFVLSADRGGCTVEDFCNQVH 326

  Fly   327 RSIAKEFKYALVWGSSVKHQPQKVGIEHVLNDEDVVQIVKK 367
            |::.|:.|||||||:|.:|.||..|:.|.|.||||||||||
plant   327 RTLVKDMKYALVWGTSARHYPQHCGLFHHLEDEDVVQIVKK 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
128upNP_536733.1 Rbg1 1..367 CDD:224085 206/364 (57%)
AT1G72660NP_001031270.1 Rbg1 1..367 CDD:224085 206/364 (57%)
DRG 64..295 CDD:206683 129/230 (56%)
TGS_DRG_C 289..366 CDD:133436 41/76 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1163
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG60797
OrthoDB 1 1.010 - - D754662at2759
OrthoFinder 1 1.000 - - FOG0001080
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.