DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 128up and DRG1

DIOPT Version :9

Sequence 1:NP_536733.1 Gene:128up / 36288 FlyBaseID:FBgn0010339 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_001077555.1 Gene:DRG1 / 838320 AraportID:AT1G17470 Length:399 Species:Arabidopsis thaliana


Alignment Length:366 Identity:209/366 - (57%)
Similarity:267/366 - (72%) Gaps:3/366 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ILEKISAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGGGTGEAGFEVAKTGDARVG 68
            |:|:|..||:|||||||||||..|||.||||:||||.:|:.|..|..|.|| ||||.|.|..||.
plant     3 IIERIKEIEAEMARTQKNKATEYHLGQLKAKIAKLRTQLLEPPKGASGGGE-GFEVTKYGHGRVA 66

  Fly    69 FVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLTTVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGR 133
            .:|||||||||||:.|.|.:||.|:|||||||.:||.|.|...||||||||||||||.:||||||
plant    67 LIGFPSVGKSTLLTMLTGTHSEAASYEFTTLTCIPGVIHYNDTKIQLLDLPGIIEGASEGKGRGR 131

  Fly   134 QVIAVARTCNLIFMVLDCLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNSMVPQS 198
            ||||||::.:|:.||||..|..||:::|..|||..|:||||.||.||:|:|..|||:.|:..|.:
plant   132 QVIAVAKSSDLVLMVLDASKSEGHRQILTKELEAVGLRLNKTPPQIYFKKKKTGGISFNTTAPLT 196

  Fly   199 ELDTDLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKIDQISIEELDVIYK 263
            .:|..|...||.|||||||::..|.:||.||.||||||||.||.|:|:.||||.:.|:::|.:.:
plant   197 HIDEKLCYQILHEYKIHNAEVLFRENATVDDFIDVIEGNRKYIKCVYVYNKIDVVGIDDVDRLSR 261

  Fly   264 IPHCVPISAHHHWNFDDLLELMWEYLRLQRIYTKPKGQLPDYNSPVVLHNER--TSIEDFCNKLH 326
            .|:.:.||.:...|.|.||..||:.:.|.|:|:||:||.||::.|.||.::|  .::|||||.:|
plant   262 QPNSIVISCNLKLNLDRLLARMWDEMGLVRVYSKPQGQQPDFDEPFVLSSDRGGCTVEDFCNHVH 326

  Fly   327 RSIAKEFKYALVWGSSVKHQPQKVGIEHVLNDEDVVQIVKK 367
            |::.|:.|||||||:|.:|.||..|:...|.||||||||||
plant   327 RTLVKDMKYALVWGTSTRHNPQNCGLSQHLEDEDVVQIVKK 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
128upNP_536733.1 Rbg1 1..367 CDD:224085 207/364 (57%)
DRG1NP_001077555.1 Rbg1 1..367 CDD:224085 207/364 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1163
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG60797
OrthoDB 1 1.010 - - D754662at2759
OrthoFinder 1 1.000 - - FOG0001080
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.