DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 128up and drg1

DIOPT Version :9

Sequence 1:NP_536733.1 Gene:128up / 36288 FlyBaseID:FBgn0010339 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_001016294.1 Gene:drg1 / 549048 XenbaseID:XB-GENE-980752 Length:367 Species:Xenopus tropicalis


Alignment Length:367 Identity:299/367 - (81%)
Similarity:334/367 - (91%) Gaps:0/367 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSTILEKISAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGGGTGEAGFEVAKTGDA 65
            ||..|.||:.||||||||||||||:.|||||||:|||||||||:|||||||....||:|||||||
 Frog     1 MSGTLAKIAEIESEMARTQKNKATAHHLGLLKARLAKLRRELITPKGGGGGGPGEGFDVAKTGDA 65

  Fly    66 RVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLTTVPGCIKYKGAKIQLLDLPGIIEGAKDGKG 130
            |:|||||||||||||||||||||||||||||||||||||.::|||||||||||||||||||||||
 Frog    66 RIGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLTTVPGVVRYKGAKIQLLDLPGIIEGAKDGKG 130

  Fly   131 RGRQVIAVARTCNLIFMVLDCLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNSMV 195
            |||||||||||||||.:|||.||||||||::|:|||||||||||:||||.:|:||||||||.:..
 Frog   131 RGRQVIAVARTCNLILIVLDVLKPLGHKKIIENELEGFGIRLNKQPPNIGFKKKDKGGINLTATC 195

  Fly   196 PQSELDTDLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKIDQISIEELDV 260
            .|||||.|.||:||:||||||||||||.|||:||||||:||||:||||||:||||||||:||||:
 Frog   196 AQSELDNDTVKSILAEYKIHNADITLRSDATADDLIDVVEGNRVYIPCIYVLNKIDQISVEELDI 260

  Fly   261 IYKIPHCVPISAHHHWNFDDLLELMWEYLRLQRIYTKPKGQLPDYNSPVVLHNERTSIEDFCNKL 325
            |||:||||||||||.||||||||.:|:||:|.|||||||||||||.|||||...||:.||||.|:
 Frog   261 IYKVPHCVPISAHHRWNFDDLLEKIWDYLQLVRIYTKPKGQLPDYTSPVVLPFSRTAAEDFCTKI 325

  Fly   326 HRSIAKEFKYALVWGSSVKHQPQKVGIEHVLNDEDVVQIVKK 367
            |:::.|||||||||||||||.|||||.:|||.||||:|||||
 Frog   326 HKNLIKEFKYALVWGSSVKHNPQKVGKDHVLEDEDVIQIVKK 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
128upNP_536733.1 Rbg1 1..367 CDD:224085 297/365 (81%)
drg1NP_001016294.1 Rbg1 1..367 CDD:224085 297/365 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 189 1.000 Domainoid score I3235
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H3060
Inparanoid 1 1.050 617 1.000 Inparanoid score I879
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D348788at33208
OrthoFinder 1 1.000 - - FOG0001080
OrthoInspector 1 1.000 - - oto103921
Panther 1 1.100 - - LDO PTHR43127
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3699
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.160

Return to query results.
Submit another query.