DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 128up and CG10628

DIOPT Version :9

Sequence 1:NP_536733.1 Gene:128up / 36288 FlyBaseID:FBgn0010339 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_609999.2 Gene:CG10628 / 35263 FlyBaseID:FBgn0032818 Length:383 Species:Drosophila melanogaster


Alignment Length:224 Identity:64/224 - (28%)
Similarity:97/224 - (43%) Gaps:61/224 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 GGGGGTGEAGFEVAKTGDAR-----------VGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT 100
            ||.||.....| :.:.|:.|           ||.||||:.||||||..::....::|||.|||:.
  Fly   130 GGTGGCTATNF-LGRPGENRTVNLDLKLIADVGLVGFPNAGKSTLLKAVSNAKPKIAAYPFTTIR 193

  Fly   101 TVPGCIKYKGAK-IQLLDLPGIIEGAKDGKGRGRQVIA-VARTCNLIFMV-------------LD 150
            ...|.|:|:..: |.:.||||:||||....|.|.:.:. :.||..|:|||             .|
  Fly   194 PQIGTIEYRDLRSITVADLPGLIEGAHANFGMGHKFLKHIERTRLLVFMVDIFGFQLSPKHPHRD 258

  Fly   151 CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGG--------------------------- 188
            |   |.:...|..|||.:...|.:||..:...:.||.|                           
  Fly   259 C---LANVYALNKELELYDPSLLEKPSVLLLNKMDKEGAHEIFTKVKPLVSDLASGLEQCPEELR 320

  Fly   189 ----INLNSMVPQSELDTDLVKTILSEYK 213
                :|.:|:||.|.:::..:..:.|:.:
  Fly   321 PKQVLNFDSIVPISAMNSSKITQVKSQLR 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
128upNP_536733.1 Rbg1 1..367 CDD:224085 64/224 (29%)
CG10628NP_609999.2 obgE 24..352 CDD:237048 64/224 (29%)
GTP1_OBG 24..>127 CDD:279370
Obg 158..352 CDD:206685 57/195 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452771
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.