DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 128up and CG13390

DIOPT Version :9

Sequence 1:NP_536733.1 Gene:128up / 36288 FlyBaseID:FBgn0010339 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_609218.1 Gene:CG13390 / 34154 FlyBaseID:FBgn0032031 Length:381 Species:Drosophila melanogaster


Alignment Length:234 Identity:71/234 - (30%)
Similarity:98/234 - (41%) Gaps:40/234 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GLLKAKLAKLRRELISPKGGGGGTGEAGF-----------EVAKTGD-----------ARVGFVG 71
            |.:...|.:.....::.:||.||.|...|           |....|:           |.||.:|
  Fly   148 GQIVGDLGQADLMFVAARGGAGGKGNRFFTTDKETSPKVSEYGPRGEDLSYTLELRSMADVGLIG 212

  Fly    72 FPSVGKSTLLSNLAGVYSEVAAYEFTTLTTVPGCIKYKG-AKIQLLDLPGIIEGAKDGKGRGRQV 135
            :|:.||||||:.|.....:||.|.||||....|.::|.. .::.:.||||::..|...||.|.|.
  Fly   213 YPNAGKSTLLNALTRAKPKVAPYAFTTLRPHLGTVQYDDHVQLTIADLPGLVPDAHRNKGLGIQF 277

  Fly   136 IAVARTCNLIFMVLDCL--KPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKD--KGGINLNSMVP 196
            :..|..|.|:..|||..  :|..|.:.|.|||..||.||..:|..:...:.|  :|..|.     
  Fly   278 LKHAERCTLLLFVLDASAPEPWTHYEQLMHELRQFGGRLASRPQLVVANKLDVEEGQNNF----- 337

  Fly   197 QSELDTDLVKTIL--SEYKIHNA-----DITLRYDATSD 228
             .||...|...:|  |....||.     .|...||...|
  Fly   338 -EELQRRLQNPVLGISAKMGHNLGQLLNSIRRGYDRHKD 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
128upNP_536733.1 Rbg1 1..367 CDD:224085 71/234 (30%)
CG13390NP_609218.1 Obg_CgtA 52..366 CDD:274271 67/223 (30%)
GTP1_OBG 52..202 CDD:279370 10/53 (19%)
Obg 206..368 CDD:206685 58/167 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452768
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.