DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mppe and Mppe1

DIOPT Version :9

Sequence 1:NP_001286327.1 Gene:Mppe / 36285 FlyBaseID:FBgn0259985 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_001101905.1 Gene:Mppe1 / 361344 RGDID:1309184 Length:394 Species:Rattus norvegicus


Alignment Length:400 Identity:81/400 - (20%)
Similarity:149/400 - (37%) Gaps:112/400 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SLRVVNRNRLVCRGFVALTLLLVFFNEFIVYYMA--QSSWQPIDC-----KLDNCTRLLLIADPQ 60
            :..::.|.|::......:.:.::.|.|:.:||:.  :..|..:..     :.:...:.:.:||..
  Rat    12 NFHLLRRRRVLLLKLTVVVISVLLFCEYFIYYLVLFRCHWPEVKMPARGGRQEPVLKAMFLADTH 76

  Fly    61 ILGNSYDRSSHSPLARYDSDRYLAKTFERALAFTQPHIIVFLGDLLDEGNIATAQEYKQYVQRFR 125
            :||   :...|. |.:...:..:.:.|:.||...||.::..|||:.|||..::||.:...:.||:
  Rat    77 LLG---EIRGHW-LDKLRREWQMERAFQTALWLLQPEVVFILGDVFDEGKWSSAQAWADDLHRFQ 137

  Fly   126 RIYQNKNYKKFRMISAFFQRVHVPGDNDIGGENGDYISNSNQRRFENEFMSEDLFDYDNRLRFFK 190
            |::::.::.:.::         |.|::|||...  .:|.....|||..|.||.||.... :.|..
  Rat   138 RMFRHGSHVQLKV---------VIGNHDIGFHY--QMSKYRINRFEKVFGSERLFSLKG-VNFVM 190

  Fly   191 INRMLL-------------DFSNPDRDNNADRLRI-GVSH----------APLLIGGGPLLRAII 231
            :|.:.:             :.....|..|..:.:: |.|.          ||:|:...||.||  
  Rat   191 VNSVAMEGDGCTICSEAEAELREISRKLNCSQEQVQGSSQCDHEPRLPLSAPVLLQHYPLYRA-- 253

  Fly   232 SD------------------------------------LDPHIIFSGHWHESRIFIYPSTKVINF 260
            ||                                    |.|.:|.|||.|.:...::|.      
  Rat   254 SDANCSGEDAAPPEERSVPFEEKYDVLSREASQKLLWWLRPRLILSGHTHSACEVLHPG------ 312

  Fly   261 YENSVRHFDLKALKEQEHSYLEIMVPTCSYR-MGKSKIGLGYAVLENYNLSYTVLWQPNRFILLF 324
                              ...|:.||:.|:| .......:|.....:|.||...|  |....:|.
  Rat   313 ------------------GAPEVSVPSFSWRNRNNPSFIMGSLTSRDYALSKCYL--PCEDTVLT 357

  Fly   325 TYVFWGLFVV 334
            ||.....|::
  Rat   358 TYCAAAAFLL 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MppeNP_001286327.1 Metallophos 52..246 CDD:278574 57/253 (23%)
MPP_Cdc1_like_1 54..293 CDD:277373 64/299 (21%)
Mppe1NP_001101905.1 Metallophos 67..303 CDD:278574 57/253 (23%)
MPP_MPPE1 70..327 CDD:277372 64/298 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3662
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094620at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.