DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mppe and SPAC630.12

DIOPT Version :9

Sequence 1:NP_001286327.1 Gene:Mppe / 36285 FlyBaseID:FBgn0259985 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_592908.1 Gene:SPAC630.12 / 2543429 PomBaseID:SPAC630.12 Length:422 Species:Schizosaccharomyces pombe


Alignment Length:405 Identity:85/405 - (20%)
Similarity:163/405 - (40%) Gaps:108/405 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LLLVFFNEFIVY--------------YMAQSSWQPIDCKLDNCTRLLLIADPQILGN-SYDRSSH 71
            |:::.|..:::|              :.:...|:    ...|..|:.|:||||::.: :||..  
pombe     7 LVIIAFCFYVLYLEKIIHTRPHKKCDWRSWEQWE----STGNPVRIALVADPQLVDDLTYDYP-- 65

  Fly    72 SPL---ARYDSDRYLAKTFERALAFTQPHIIVFLGDLLDEGNIATAQEYKQYVQRFRRIYQNKNY 133
            .||   .::.||::|.:.:.......:|.|...:|||:|.|.....:|:|            |:|
pombe    66 RPLIGIVKWISDQFLRRHWRYLHKSLKPDITFIMGDLMDTGREFATEEFK------------KDY 118

  Fly   134 KKFRMISA----FFQRVHV-PGDNDIGGENGDYISNSNQRRFENEF----MSEDLFDY------- 182
              |||::.    |..::.: ||::|||  .|::....:.:|||:.|    .|.|:.::       
pombe   119 --FRMMNVLDPKFTNKLEIYPGNHDIG--FGNHAIVKDIQRFESLFGPTSRSIDVGNHTLVIVDG 179

  Fly   183 ---DNRL--RFFKINRMLLDFSNPDRDNNADRLRIGVSHAPLLIGGGPLLRAI--ISDLDPHIIF 240
               .|.:  :.::..|..|.....::||:  |.||.:||.||.   .|.:.:.  :.:.|..|.:
pombe   180 IRLSNNVNPQVYQPARDFLKSFETNKDNS--RPRILLSHVPLF---RPAINSCGELREKDDVIKY 239

  Fly   241 S-GHWHESRIFIYPSTKVINFYENSVRHFDLKALKEQEHSYLEIM---------VPTCSYR---- 291
            . |:.:::.:....|..::...|      .:.|....:|.|.|::         ..|..|.    
pombe   240 GLGYQYQNLLLPELSESILKAVE------PIAAFAGDDHDYCEVVHNYQVDTREAATTEYNVKAF 298

  Fly   292 -MGKSKIGLGYAVL--------------ENYNLSYTVLWQPNRFILLFTYVFWGLFVVCGFVVFK 341
             |....:..||.:|              .:|.....:|  ||:..:   ||::|..:...|.:..
pombe   299 SMTSGILYPGYQLLSLNYPYDNPKADQKSSYQTKLCIL--PNQIQI---YVWYGASISIFFALIL 358

  Fly   342 MMTRCPFRVAKRQTL 356
            :.|...|....|.:|
pombe   359 LRTAIFFFGTDRYSL 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MppeNP_001286327.1 Metallophos 52..246 CDD:278574 56/221 (25%)
MPP_Cdc1_like_1 54..293 CDD:277373 63/280 (23%)
SPAC630.12NP_592908.1 MPP_Cdc1 49..303 CDD:277370 64/282 (23%)
Metallophos 80..241 CDD:278574 43/181 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3662
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13315
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1923
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.