DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otk2 and Ptk7

DIOPT Version :10

Sequence 1:NP_612571.1 Gene:otk2 / 36284 FlyBaseID:FBgn0267728 Length:433 Species:Drosophila melanogaster
Sequence 2:XP_006524986.1 Gene:Ptk7 / 71461 MGIID:1918711 Length:1088 Species:Mus musculus


Alignment Length:396 Identity:125/396 - (31%)
Similarity:182/396 - (45%) Gaps:60/396 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 LQLPCDYQLPD---GYLQ-------KSSVILRWRKDSKTLRQVELGRMDSTTSEPQLETMLREDS 105
            |:.|.|.||.:   |||.       |.:||  |.::                     :.::.|||
Mouse   433 LRKPQDSQLEEGKPGYLHCLTQATPKPTVI--WYRN---------------------QMLISEDS 474

  Fly   106 RVALSKDSGALQFTSVLASDAGQYQCQLVIDDSVAAS-SSSGVLLVIEQLKFVPQPTSKN-LELG 168
            |..:|| :|.|:..||...|...|:|   :..:.|.| .:...:.|:|:|||.|.|..:. :|..
Mouse   475 RFEVSK-NGTLRINSVEVYDGTLYRC---VSSTPAGSIEAQARVQVLEKLKFTPPPQPQQCMEFD 535

  Fly   169 TLSKVHCKAQGTPAPQVKWMRETQLPLPVNVTDQNGTLIFNQVSNEQRGQYTCIASNS-QGQITA 232
            ..:.|.|.|.|...|.|||:|.....||..|||..|||.|.:|:.:..|.|||||||. ||||.|
Mouse   536 KEATVPCSATGREKPTVKWVRADGSSLPEWVTDNAGTLHFARVTRDDAGNYTCIASNEPQGQIRA 600

  Fly   233 TVSINVVVAPKFSVPPEGPIEVAEAGTAVIHCQAIGEPKPTIQWDKDLTYLNENNTDPERFSLME 297
            .|.:.|.|...|.|.|| ...|.:..||::.|:|.|:|||.|||......|:.....| |..:.:
Mouse   601 HVQLTVAVFITFKVEPE-RTTVYQGHTALLRCEAQGDPKPLIQWKGKDRILDPTKLGP-RMHIFQ 663

  Fly   298 NGTLEIRNVRPEDEGRYGCTIGSSAGLKREDVLL------VLKSSKSASNSIVTRIIIVI---IC 353
            ||:|.|.:|.|||.|.|.|..|:|..::..:..|      |::.|:...:....::|..|   :.
Mouse   664 NGSLVIHDVAPEDSGSYTCIAGNSCNIRHTEAPLLVVDKPVMEDSEGPGSPPPYKMIQTIGLSVG 728

  Fly   354 LAFLYFVLVLGLKVWYRYRRHLGKVQLE-DGHV-------NGP-TDGQEHDHHENEPCLTEANSS 409
            .|..|.:.||||..:.:.|....::|.: :|..       .|| .:||.....:.|..||...|.
Mouse   729 AAVAYIIAVLGLMFYCKKRCKAKRLQKQPEGEEPEMECLNGGPLQNGQPSAEIQEEVALTSLGSG 793

  Fly   410 KNLKSK 415
            ....:|
Mouse   794 PPATNK 799

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otk2NP_612571.1 Ig <98..>131 CDD:472250 12/32 (38%)
Ig strand E 114..118 CDD:409560 2/3 (67%)
Ig_3 155..225 CDD:464046 30/70 (43%)
Ig 249..323 CDD:472250 29/73 (40%)
Ig strand B 260..264 CDD:409544 1/3 (33%)
Ig strand C 273..277 CDD:409544 2/3 (67%)
Ig strand E 299..303 CDD:409544 2/3 (67%)
Ig strand F 313..318 CDD:409544 2/4 (50%)
Ptk7XP_006524986.1 Ig_3 51..122 CDD:464046
Ig2_PTK7 146..240 CDD:409417
Ig strand B 164..168 CDD:409417
Ig strand C 177..181 CDD:409417
Ig strand E 201..205 CDD:409417
Ig strand F 215..220 CDD:409417
Ig strand G 227..230 CDD:409417
Ig_3 244..320 CDD:464046
Ig 345..426 CDD:472250
Ig strand B 357..361 CDD:409353
Ig strand C 371..375 CDD:409353
Ig strand E 391..395 CDD:409353
Ig strand F 406..411 CDD:409353
Ig strand G 419..422 CDD:409353
Ig 430..516 CDD:472250 27/109 (25%)
Ig strand B 447..451 CDD:409353 3/3 (100%)
Ig strand C 460..464 CDD:409353 2/5 (40%)
Ig strand E 482..486 CDD:409353 2/3 (67%)
Ig strand F 496..501 CDD:409353 2/7 (29%)
Ig strand G 509..512 CDD:409353 0/2 (0%)
Ig 521..606 CDD:472250 38/84 (45%)
Ig strand B 538..542 CDD:409353 1/3 (33%)
Ig strand C 551..555 CDD:409353 2/3 (67%)
Ig strand E 571..575 CDD:409353 3/3 (100%)
Ig strand F 585..590 CDD:409353 3/4 (75%)
Ig strand G 599..602 CDD:409353 1/2 (50%)
Ig_3 611..686 CDD:464046 30/76 (39%)
PTK_CCK4 808..1081 CDD:133178
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.