Sequence 1: | NP_612571.1 | Gene: | otk2 / 36284 | FlyBaseID: | FBgn0267728 | Length: | 433 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006498564.1 | Gene: | Hmcn2 / 665700 | MGIID: | 2677838 | Length: | 5092 | Species: | Mus musculus |
Alignment Length: | 330 | Identity: | 83/330 - (25%) |
---|---|---|---|
Similarity: | 139/330 - (42%) | Gaps: | 69/330 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 24 YAAPASFEDVSISRGPKSSITIKEQSSLQLPCD-YQLPDGYLQKSSVILRWRKDSKTLRQVELGR 87
Fly 88 MDSTTSEPQLETMLREDSRVALSKDSGALQFTSVLASDAGQYQCQLVIDDSVAASSSSGV-LLVI 151
Fly 152 EQLKFVPQPTSKNLELGTLSKVHCKAQGTPAPQVKWMRETQLPLPVNVTDQNG--------TLIF 208
Fly 209 NQVSNEQRGQYTCIASNSQGQITATVSINVVVAP-------KFSVPPEGPIEVAEAGTAVIHCQA 266
Fly 267 IGEPKPTIQWDKDLTYLNENNTDPERFSLMENGTLEIRNVRPEDEGRYGCTIGSSAGLKREDVLL 331
Fly 332 VLKSS 336 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
otk2 | NP_612571.1 | IG_like | 41..132 | CDD:214653 | 21/91 (23%) |
I-set | 155..238 | CDD:254352 | 20/90 (22%) | ||
IGc2 | 175..228 | CDD:197706 | 16/60 (27%) | ||
IG_like | 250..331 | CDD:214653 | 23/80 (29%) | ||
IGc2 | 258..323 | CDD:197706 | 19/64 (30%) | ||
Hmcn2 | XP_006498564.1 | vWFA | 38..196 | CDD:238119 | |
Ig | 445..511 | CDD:319273 | |||
IG | 525..605 | CDD:214652 | |||
I-set | 609..693 | CDD:369462 | |||
IG | 707..783 | CDD:214652 | |||
IG_like | 793..876 | CDD:214653 | |||
I-set | 889..969 | CDD:369462 | |||
Ig | 992..1058 | CDD:386229 | |||
IG | 1076..1157 | CDD:214652 | |||
Ig | 1161..1242 | CDD:386229 | |||
Ig | 1262..1336 | CDD:386229 | |||
I-set | 1345..1429 | CDD:369462 | |||
I-set | 1449..1523 | CDD:369462 | |||
IG | 1553..1633 | CDD:214652 | |||
IGc2 | 1654..1716 | CDD:197706 | |||
Ig | 1741..1819 | CDD:386229 | |||
Ig | 1839..1903 | CDD:386229 | |||
I-set | 1907..1986 | CDD:369462 | |||
Ig_3 | 1998..2073 | CDD:372822 | |||
Ig | 2092..2179 | CDD:386229 | |||
Ig | 2183..2273 | CDD:386229 | |||
Ig | 2291..2367 | CDD:386229 | |||
IGc2 | 2389..2451 | CDD:197706 | |||
I-set | 2476..2554 | CDD:369462 | |||
I-set | 2558..2650 | CDD:369462 | |||
I-set | 2668..2740 | CDD:369462 | |||
Ig | 2782..2859 | CDD:386229 | |||
I-set | 2876..2954 | CDD:369462 | |||
I-set | 2966..3046 | CDD:369462 | |||
I-set | 3050..3141 | CDD:369462 | |||
Ig | 3145..3233 | CDD:386229 | |||
Ig | 3256..3320 | CDD:319273 | |||
Ig | 3347..3422 | CDD:386229 | |||
IG_like | 3436..3511 | CDD:214653 | |||
IGc2 | 3530..3592 | CDD:197706 | |||
Ig | 3614..3695 | CDD:386229 | |||
I-set | 3699..3786 | CDD:369462 | 30/124 (24%) | ||
Ig | 3789..3874 | CDD:386229 | 20/87 (23%) | ||
Ig | 3900..3967 | CDD:319273 | 22/77 (29%) | ||
I-set | 3974..4060 | CDD:369462 | 83/330 (25%) | ||
Ig | 4064..4151 | CDD:386229 | |||
I-set | 4155..4240 | CDD:369462 | |||
IGc2 | 4259..4321 | CDD:197706 | |||
I-set | 4335..4421 | CDD:369462 | |||
G2F | 4423..4605 | CDD:369383 | |||
FXa_inhibition | 4664..4699 | CDD:373209 | |||
EGF_CA | 4701..4744 | CDD:311536 | |||
EGF_CA | 4746..4783 | CDD:214542 | |||
EGF_CA | 4789..4829 | CDD:214542 | |||
EGF_CA | 4896..4935 | CDD:214542 | |||
EGF_CA | 4936..4974 | CDD:214542 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4475 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |