DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otk2 and PTK7

DIOPT Version :9

Sequence 1:NP_612571.1 Gene:otk2 / 36284 FlyBaseID:FBgn0267728 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_001257327.1 Gene:PTK7 / 5754 HGNCID:9618 Length:1078 Species:Homo sapiens


Alignment Length:412 Identity:131/412 - (31%)
Similarity:187/412 - (45%) Gaps:64/412 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 SITIKEQSS-LQLPCDYQLPD---GYLQ-------KSSVILRWRKDSKTLRQVELGRMDSTTSEP 95
            :||:....| |:.|.|.||.:   |||.       |.:|:  |.::                   
Human   413 NITVATVPSWLKKPQDSQLEEGKPGYLDCLTQATPKPTVV--WYRN------------------- 456

  Fly    96 QLETMLREDSRVALSKDSGALQFTSVLASDAGQYQCQLVIDDSVAASS--SSGVLLVIEQLKFVP 158
              :.::.||||..:.| :|.|:..||...|...|:|.    .|..|.|  :...:.|:|:|||.|
Human   457 --QMLISEDSRFEVFK-NGTLRINSVEVYDGTWYRCM----SSTPAGSIEAQARVQV
LEKLKFTP 514

  Fly   159 QPTSKN-LELGTLSKVHCKAQGTPAPQVKWMRETQLPLPVNVTDQNGTLIFNQVSNEQRGQYTCI 222
            .|..:. :|....:.|.|.|.|...|.:||.|.....||..|||..|||.|.:|:.:..|.||||
Human   515 PPQPQQCMEFDKEATVPCSATGREKPTIKWERADGSSLPEWVTDNAGTLHFARVTRDDAGNYTCI 579

  Fly   223 ASNS-QGQITATVSINVVVAPKFSVPPEGPIEVAEAGTAVIHCQAIGEPKPTIQWDKDLTYLNEN 286
            |||. ||||.|.|.:.|.|...|.|.|| ...|.:..||::.|:|.|:|||.|||......|:..
Human   580 ASNGPQGQIRAHVQLTV
AVFITFKVEPE-RTTVYQGHTALLQCEAQGDPKPLIQWKGKDRILDPT 643

  Fly   287 NTDPERFSLMENGTLEIRNVRPEDEGRYGCTIGSSAGLKREDVLL------VLKSSKSASNSIVT 345
            ...| |..:.:||:|.|.:|.|||.|||.|..|:|..:|..:..|      |.:.|:...:....
Human   644 KLGP-RMHIFQNGSLVIHDVAPEDSGRYTCIAGNSCNIKHTEAPLYVVDKPVPEESEGPGSPPPY 707

  Fly   346 RIIIVI---ICLAFLYFVLVLGLKVWYRYRRHLGKVQLE-DGHV-------NGP-TDGQEHDHHE 398
            ::|..|   :..|..|.:.||||..:.:.|....::|.: :|..       .|| .:||.....:
Human   708 KMIQTIGLSVGAAVAYIIAVLGLMFYCKKRCKAKRLQKQPEGEEPEMECLNGGPLQNGQPSAEIQ 772

  Fly   399 NEPCLTEANSSKNLKSKLREST 420
            .|..||...|.....:| |.||
Human   773 EEVALTSLGSGPAATNK-RHST 793

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otk2NP_612571.1 IG_like 41..132 CDD:214653 25/100 (25%)
I-set 155..238 CDD:254352 37/84 (44%)
IGc2 175..228 CDD:197706 25/53 (47%)
IG_like 250..331 CDD:214653 30/80 (38%)
IGc2 258..323 CDD:197706 28/64 (44%)
PTK7NP_001257327.1 IG_like 46..120 CDD:214653
IGc2 53..113 CDD:197706
Ig2_PTK7 154..230 CDD:143237
IG_like 239..>309 CDD:214653
Ig 250..310 CDD:143165
IG 348..416 CDD:214652 1/2 (50%)
IGc2 348..406 CDD:197706
I-set 420..506 CDD:254352 27/113 (24%)
Ig 422..506 CDD:299845 26/111 (23%)
I-set 511..596 CDD:254352 37/84 (44%)
IGc2 528..582 CDD:197706 24/53 (45%)
IG_like 606..689 CDD:214653 33/84 (39%)
IGc2 613..677 CDD:197706 27/64 (42%)
PTK_CCK4 798..1071 CDD:133178
STYKc 809..1069 CDD:214568
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147251
Domainoid 1 1.000 55 1.000 Domainoid score I11116
eggNOG 1 0.900 - - E1_KOG4475
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D245153at33208
OrthoFinder 1 1.000 - - FOG0007317
OrthoInspector 1 1.000 - - otm41120
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.