Sequence 1: | NP_612571.1 | Gene: | otk2 / 36284 | FlyBaseID: | FBgn0267728 | Length: | 433 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001018501.1 | Gene: | ptk7a / 553690 | ZFINID: | ZDB-GENE-050522-216 | Length: | 231 | Species: | Danio rerio |
Alignment Length: | 207 | Identity: | 53/207 - (25%) |
---|---|---|---|
Similarity: | 85/207 - (41%) | Gaps: | 35/207 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 142 SSSSGVLLVI-----------EQLKFVPQPTSKNLELGTLSKVHCKAQGTPAPQVKWMRETQLPL 195
Fly 196 PVNVTDQ----NGTLIFNQVSNE-QRGQYTCIAS-NSQG--QITATVSINVVVAPKFSV---PPE 249
Fly 250 GPIEVAEAGTAVIHCQAIGEPKPTIQWDKDLTYLNENN---TDPERFSLMENGTLEIRNVRPEDE 311
Fly 312 GRYGCTIGSSAG 323 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
otk2 | NP_612571.1 | IG_like | 41..132 | CDD:214653 | |
I-set | 155..238 | CDD:254352 | 22/90 (24%) | ||
IGc2 | 175..228 | CDD:197706 | 14/58 (24%) | ||
IG_like | 250..331 | CDD:214653 | 23/77 (30%) | ||
IGc2 | 258..323 | CDD:197706 | 20/67 (30%) | ||
ptk7a | NP_001018501.1 | I-set | 37..120 | CDD:254352 | 20/85 (24%) |
Ig | 42..122 | CDD:299845 | 20/82 (24%) | ||
Ig | 150..222 | CDD:299845 | 22/67 (33%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170580766 | |
Domainoid | 1 | 1.000 | 69 | 1.000 | Domainoid score | I9605 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D245153at33208 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0007317 | |
OrthoInspector | 1 | 1.000 | - | - | otm26203 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
6 | 5.850 |