DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otk2 and ptk7a

DIOPT Version :9

Sequence 1:NP_612571.1 Gene:otk2 / 36284 FlyBaseID:FBgn0267728 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_001018501.1 Gene:ptk7a / 553690 ZFINID:ZDB-GENE-050522-216 Length:231 Species:Danio rerio


Alignment Length:207 Identity:53/207 - (25%)
Similarity:85/207 - (41%) Gaps:35/207 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 SSSSGVLLVI-----------EQLKFVPQPTSKNLELGTLSKVHCKAQGTPAPQVKWMRETQLPL 195
            :|:..|||.:           ....|...|.|::...|..:.:.|:..........|::..:   
Zfish    13 ASAENVLLALTLIGEVIMAQAASFYFTKAPKSQDALHGRSAMLRCEVNDPQGVSYAWIQNGE--- 74

  Fly   196 PVNVTDQ----NGTLIFNQVSNE-QRGQYTCIAS-NSQG--QITATVSINVVVAPKFSV---PPE 249
            ||..:::    .|.|.|..:... ..|.:.|||| ||.|  :.||..|.|:......:|   .||
Zfish    75 PVTNSERRFLDGGNLKFTAIDRTLDSGNFQCIASKNSTGEEERTAETSFNIKWLESGAVSLKSPE 139

  Fly   250 GPIEVAEAGTAVIHCQAIGEPKPTIQWDKDLTYLNENN---TDPERFSLMENGTLEIRNVRPEDE 311
            ...|:..:...::.|...|.|:||.:|.||.|.:.|.|   .:.||       :|.:.|..|:|.
Zfish   140 SVAEIQSSSQVILRCNIDGHPRPTNRWFKDGTQITEKNYKINNKER-------SLTLPNASPDDN 197

  Fly   312 GRYGCTIGSSAG 323
            |.|.|...::||
Zfish   198 GLYFCCAKNAAG 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otk2NP_612571.1 IG_like 41..132 CDD:214653
I-set 155..238 CDD:254352 22/90 (24%)
IGc2 175..228 CDD:197706 14/58 (24%)
IG_like 250..331 CDD:214653 23/77 (30%)
IGc2 258..323 CDD:197706 20/67 (30%)
ptk7aNP_001018501.1 I-set 37..120 CDD:254352 20/85 (24%)
Ig 42..122 CDD:299845 20/82 (24%)
Ig 150..222 CDD:299845 22/67 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580766
Domainoid 1 1.000 69 1.000 Domainoid score I9605
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D245153at33208
OrthoFinder 1 1.000 - - FOG0007317
OrthoInspector 1 1.000 - - otm26203
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.