DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otk2 and LRRN3

DIOPT Version :10

Sequence 1:NP_612571.1 Gene:otk2 / 36284 FlyBaseID:FBgn0267728 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_060804.3 Gene:LRRN3 / 54674 HGNCID:17200 Length:708 Species:Homo sapiens


Alignment Length:400 Identity:80/400 - (20%)
Similarity:142/400 - (35%) Gaps:145/400 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SYAAPASF------EDVSISRGPKSSI---------TIKEQS--SLQLPCDYQLPDGYLQKSSVI 70
            ||..|.:|      |.:.::....|::         .:||.|  |..:.||            .:
Human   323 SYIHPNAFFRLPKLESLMLNSNALSALYHGTIESLPNLKEISIHSNPIRCD------------CV 375

  Fly    71 LRWRKDSKTLRQVELGRMDSTTSEPQLETMLREDSRVALSKDSGALQFTSVLASDAGQYQCQLVI 135
            :||...:||         :....||.                       |:...|..::|.|.| 
Human   376 IRWMNMNKT---------NIRFMEPD-----------------------SLFCVDPPEFQGQNV- 407

  Fly   136 DDSVAASSSSGVLLVIEQLKF-----------VPQ--PTSKNLELGTLSKVHCKAQGTPAPQVKW 187
                            .|:.|           .|:  |::.|:|.|:....||:|...|.|::.|
Human   408 ----------------RQVHFRDMMEICLPLIAPESFPSNLNVEAGSYVSFHCRATAEPQPEIYW 456

  Fly   188 MRET-QLPLPVNVTDQ-----NGTLIFNQVSNEQRGQYTCIASNSQGQITATVSINVVVAPKFSV 246
            :..: |..||..:||:     .|||..|.|:.::.|.|||||:|..|....:|.|.  |...|..
Human   457 ITPSGQKLLPNTLTDKFYVHSEGTLDINGVTPKEGGLYTCIATNLVGADLKSVMIK--VDGSFPQ 519

  Fly   247 PPEGPIEV----AEAGTAVIHCQAIGE-PKPTIQWDK----------------------DLTYLN 284
            ...|.:.:    .:|.:.::..:|..: .|.:::|..                      :||:||
Human   520 DNNGSLNIKIRDIQANSVLVSWKASSKILKSSVKWTAFVKTENSHAAQSARIPSDVKVYNLTHLN 584

  Fly   285 ENNTDPERFSLMENGTLEIRNVRPEDEGRYGCTIGSSAGLKREDVLLVLKSSKSASNSIVTRI-- 347
            .:.   |....::..|:..:|       |..|...::.||..:.    .:..|:.:.:::..:  
Human   585 PST---EYKICIDIPTIYQKN-------RKKCVNVTTKGLHPDQ----KEYEKNNTTTLMACLGG 635

  Fly   348 ---IIVIICL 354
               ||.:|||
Human   636 LLGIIGVICL 645

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otk2NP_612571.1 Ig <98..>131 CDD:472250 2/32 (6%)
Ig strand E 114..118 CDD:409560 0/3 (0%)
Ig_3 155..225 CDD:464046 28/88 (32%)
Ig 249..323 CDD:472250 14/100 (14%)
Ig strand B 260..264 CDD:409544 0/3 (0%)
Ig strand C 273..277 CDD:409544 0/3 (0%)
Ig strand E 299..303 CDD:409544 1/3 (33%)
Ig strand F 313..318 CDD:409544 2/4 (50%)
LRRN3NP_060804.3 LRRNT 28..72 CDD:214470
LRR <69..354 CDD:443914 6/30 (20%)
LRR 1 70..91
leucine-rich repeat 72..93 CDD:275380
LRR 2 93..114
leucine-rich repeat 94..117 CDD:275380
LRR 3 117..138
leucine-rich repeat 118..141 CDD:275380
LRR 4 141..162
leucine-rich repeat 142..165 CDD:275380
LRR 5 165..186
leucine-rich repeat 166..189 CDD:275380
LRR 6 189..210
leucine-rich repeat 190..213 CDD:275380
LRR 7 213..234
leucine-rich repeat 214..237 CDD:275380
LRR 8 237..258
leucine-rich repeat 238..261 CDD:275380
LRR 9 261..282
leucine-rich repeat 262..285 CDD:275380
LRR 10 285..304
leucine-rich repeat 286..310 CDD:275380
LRR 11 310..332 4/8 (50%)
leucine-rich repeat 311..333 CDD:275380 4/9 (44%)
LRR 12 335..358 2/22 (9%)
leucine-rich repeat 336..359 CDD:275380 2/22 (9%)
PCC 341..>442 CDD:188093 25/161 (16%)
Ig 421..513 CDD:472250 31/93 (33%)
Ig strand B 440..444 CDD:409353 0/3 (0%)
Ig strand C 453..457 CDD:409353 0/3 (0%)
Ig strand E 479..483 CDD:409353 3/3 (100%)
Ig strand F 493..498 CDD:409353 3/4 (75%)
Ig strand G 506..509 CDD:409353 0/2 (0%)
fn3 526..593 CDD:394996 9/69 (13%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.