DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otk2 and Alk

DIOPT Version :9

Sequence 1:NP_612571.1 Gene:otk2 / 36284 FlyBaseID:FBgn0267728 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_001261027.1 Gene:Alk / 53425 FlyBaseID:FBgn0040505 Length:1701 Species:Drosophila melanogaster


Alignment Length:455 Identity:81/455 - (17%)
Similarity:137/455 - (30%) Gaps:175/455 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 KDSKTLRQVELGRMDST----TSEPQLETMLREDSRVALSKDSGALQ------------------ 117
            ||.:....:||...|:.    .|:.|.|...||.::..:.::...::                  
  Fly   717 KDFEYTNYLELTTCDTRGMIGPSQAQCEAAYREQNKTHVLREVHVVEDQSSYKGMQKWKVPHEGH 781

  Fly   118 FTSVLASDAGQYQCQLVIDDSVAASSSSGVLLVI------EQLKFVPQPTSKNL---ELGTLSKV 173
            :|.:....:|.      :......||...|.:.|      |:|.|:.....:|.   .:|.|.:.
  Fly   782 YTIIAKGASGG------LGSGGVGSSRGSVAVAILELHKNEELYFLVGQQGENACIKSMGVLKEA 840

  Fly   174 HCKAQGT--PAPQVKWMRETQLPLPVNVTDQNG---------TLIFNQVSNE------------- 214
            .|   ||  .....::...::..:..|:..:||         ..:.||..||             
  Fly   841 GC---GTDHDLDLAQYSFRSKQDMVKNIYIENGAGGGGGGSYVFLLNQAKNEAVPLLVAGGGGGL 902

  Fly   215 ----------QRGQYT-CIASNSQGQITATVSINVVVAP---------KFSVPPEGP-------- 251
                      |.||.. .:.:...|||...........|         :...|..|.        
  Fly   903 GIGQYIDEDFQHGQKAKPLQAPESGQINGEPLNKKTAGPGGGWRAKEDQALSPTYGAALLQGGRG 967

  Fly   252 -----IEVAEAGTAVIH-------------CQAIGEPKPTIQWDKDLTYLNENNTDPERFSLMEN 298
                 :|:|:.||:| |             |...|........|   .||.|:|.        |.
  Fly   968 GHSCYVELADNGTSV-HRHGQGGFGGGGGGCNTGGGGGGYAGGD---VYLTESNG--------EG 1020

  Fly   299 GTLEI---RNVRPEDEGRYGCTIGSSA----------------------------------GLKR 326
            |:..|   |::|...|...|.:.|..|                                  .|||
  Fly  1021 GSSYISPSRSLREISEIHAGASSGPGAIIIIPAIEGCGCDYRCVALDEFRSKVRCICPDGWSLKR 1085

  Fly   327 ED---VLLVLKSSKSASNSIVTRIII----VIICLAFLYFVLVLGLKVWYRYRRHLGKVQLEDGH 384
            ::   ..:..::.||:...:|:.::|    :.||:|.|.|:|         |.|:..|.|.:..|
  Fly  1086 DNHTACEIREEAGKSSFQYLVSILMISLAVLFICIAALIFML---------YNRYQRKKQSKKRH 1141

  Fly   385  384
              Fly  1142  1141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otk2NP_612571.1 IG_like 41..132 CDD:214653 12/78 (15%)
I-set 155..238 CDD:254352 20/120 (17%)
IGc2 175..228 CDD:197706 13/87 (15%)
IG_like 250..331 CDD:214653 26/146 (18%)
IGc2 258..323 CDD:197706 20/114 (18%)
AlkNP_001261027.1 MAM 288..450 CDD:279023
MAM 288..447 CDD:99706
MAM 505..691 CDD:279023
MAM 505..689 CDD:99706
PTKc_ALK_LTK 1186..1462 CDD:270632
TyrKc 1193..1460 CDD:197581
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.