DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otk2 and Ror

DIOPT Version :9

Sequence 1:NP_612571.1 Gene:otk2 / 36284 FlyBaseID:FBgn0267728 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_476962.1 Gene:Ror / 34367 FlyBaseID:FBgn0010407 Length:685 Species:Drosophila melanogaster


Alignment Length:327 Identity:61/327 - (18%)
Similarity:120/327 - (36%) Gaps:73/327 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 YAAPA-SFEDVSISRGPKSSITIKEQSSLQLPCDYQLPDGYLQKSSVILRWRKDSKTLRQVELGR 87
            ||.|: .|..:.|.|.|       |:::|....:.......|:..| |.|.|..||.::.:.:.:
  Fly    93 YALPSLCFSSMPICRTP-------ERTNLLYFANVATNAKQLKNVS-IRRKRTKSKDIKNISIFK 149

  Fly    88 MDSTTSEPQLETMLREDSRVALSKDSGALQFTSVLASDAGQYQCQLVIDD------SVAASSSSG 146
            ..||..|....|.:  .|:...:::|..|:...       :.:|:|:.::      ::|......
  Fly   150 KKSTIYEDVFSTDI--SSKYPPTRESENLKRIC-------REECELLENELCQKEYAIAKRHPVI 205

  Fly   147 VLLVIEQLKFVPQPTSKN-LELGTLSKV----HC--------------KAQGTPAPQVKWMRETQ 192
            .::.:|..:.:||  .|: |.||...:|    :|              .|.|.|..:..|:.:..
  Fly   206 GMVGVEDCQKLPQ--HKDCLSLGITIEVDKTENCYWEDGSTYRGVANVSASGKPCLRWSWLMKEI 268

  Fly   193 LPLPVNVTDQNGTLIFNQVSNEQRGQYTCIASNSQGQITATVSINVVVAPKFSVPPEGPIEVAEA 257
            ...| .:..||.......|.|..    .|...:|:.:|     |.:...||.:    ..|.:|..
  Fly   269 SDFP-ELIGQNYCRNPGSVENSP----WCFVDSSRERI-----IELCDIPKCA----DKIWIAIV 319

  Fly   258 GTA--------VIHCQAIGEPKPTIQWD-KDLTYLNENNTDPERFSLMENGTLEIRNVRPEDEGR 313
            ||.        :|....:.:.:..:.:. :::..:|..:.|...:     |..::.|.:....|.
  Fly   320 GTTAAIILIFIIIFAIILFKRRTIMHYGMRNIHNINTPSADKNIY-----GNSQLNNAQDAGRGN 379

  Fly   314 YG 315
            .|
  Fly   380 LG 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otk2NP_612571.1 IG_like 41..132 CDD:214653 16/90 (18%)
I-set 155..238 CDD:254352 21/101 (21%)
IGc2 175..228 CDD:197706 12/66 (18%)
IG_like 250..331 CDD:214653 11/75 (15%)
IGc2 258..323 CDD:197706 9/67 (13%)
RorNP_476962.1 CRD_TK_ROR_like 39..228 CDD:143568 33/153 (22%)
KR 235..312 CDD:214527 16/90 (18%)
PTKc_Ror 404..673 CDD:270642
Pkinase_Tyr 410..670 CDD:285015
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.