DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otk2 and Ddr

DIOPT Version :9

Sequence 1:NP_612571.1 Gene:otk2 / 36284 FlyBaseID:FBgn0267728 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_001014474.3 Gene:Ddr / 3346209 FlyBaseID:FBgn0053531 Length:1054 Species:Drosophila melanogaster


Alignment Length:223 Identity:44/223 - (19%)
Similarity:83/223 - (37%) Gaps:78/223 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 ASFEDVSISRG-------PKSSITIKEQ------SSLQLPCDYQLPDGYLQKSSVI-------LR 72
            |:|.|::..|.       |:.|:.|.|:      ..|.| |:..:.:..|...:.:       ||
  Fly   737 ANFADINEERANCQVQEFPRQSLVIVEKLGSGVFGELHL-CETNVLNATLVAVATLRPGANDHLR 800

  Fly    73 --WRKDSKTLRQVELGRMDSTTSEPQLETM----LREDSRVALSKDSGAL----QF--------T 119
              :|..:|.|.|:         |:|.:..:    ||::....:...|..|    ||        :
  Fly   801 KEFRSKAKQLAQL---------SDPNVARLVGACLRDEPICIVQDYSHCLGDLNQFLQEHVAETS 856

  Fly   120 SVLASDAGQYQCQLVIDDSVAASSSSGVLLVIEQLKFV------------PQPTSKNLELGTL-- 170
            .::|..:..:.|.:.|...:|:....     :||:.||            |:...|...:||:  
  Fly   857 GLMAKKSLSFGCLVYIATQIASGMKH-----LEQMNFVHRDLATRSCIIGPELCVKVCSIGTVIN 916

  Fly   171 ----SKVHCKAQG------TPAPQVKWM 188
                :..:|:.:|      .|.| ::||
  Fly   917 RSAYASDYCQLEGFTGRQSQPMP-IRWM 943

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otk2NP_612571.1 IG_like 41..132 CDD:214653 22/121 (18%)
I-set 155..238 CDD:254352 12/58 (21%)
IGc2 175..228 CDD:197706 6/20 (30%)
IG_like 250..331 CDD:214653
IGc2 258..323 CDD:197706
DdrNP_001014474.3 FA58C 106..262 CDD:214572
FA58C 109..261 CDD:238014
PTKc_DDR 753..1040 CDD:270644 40/207 (19%)
TyrKc 759..1038 CDD:197581 38/201 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.