DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otk2 and f11r.1

DIOPT Version :9

Sequence 1:NP_612571.1 Gene:otk2 / 36284 FlyBaseID:FBgn0267728 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_001004667.1 Gene:f11r.1 / 323696 ZFINID:ZDB-GENE-030131-2416 Length:292 Species:Danio rerio


Alignment Length:274 Identity:63/274 - (22%)
Similarity:97/274 - (35%) Gaps:62/274 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 GQYQCQLVIDDSVAASSSSGVLLVIEQLKFVPQPTSKNLELGTLSKVHCKAQ------------G 179
            |.:..|:.:...|....:.||.|          ..|...:.|...:|..|.:            |
Zfish    15 GIHGFQVTVTSPVKVKENEGVDL----------QCSYTSDFGATPRVEWKFKDLKGSQTLVYFDG 69

  Fly   180 TPAPQVKWMRETQLPLPVNVTDQNGTLIFNQVSNEQRGQYTCIASNSQGQITATVSINVVVAPKF 244
            .|..|...          .||..:..|.||:|:....|.|.|..|.|.|....|:.:.|:     
Zfish    70 KPTGQYTG----------RVTMYDKGLRFNKVTRADTGDYDCEVSGSGGYGENTIKLTVL----- 119

  Fly   245 SVPPEGPI-----EVAEAGTAVIHC-QAIGEPKPTIQWDKDLTYLNENNTDPERFSLME------ 297
             |||..|:     .|..:....:.| ..:|.|..|.:|.||.|.|.|   ||.:|...:      
Zfish   120 -VPPAKPVSRIPSSVTTSSNVRLTCFDPVGSPPSTYKWYKDNTPLPE---DPTKFPAFKNLTYKM 180

  Fly   298 ---NGTLEIRNVRPEDEGRYGCTIGSSAGLKREDVLLVLKSSKSASNSIVTRIIIVIICLAFLYF 359
               ||.||..:|...|.|.|.|...:..|:.:....:.::........||..:|:.::.:..|.|
Zfish   181 NVFNGNLEFPSVSKMDTGSYFCEASNGEGVPQRGDEVKMEVRDLNVGGIVAGVIVALLAVGLLLF 245

  Fly   360 VLVLGLKVWYRYRR 373
            .|      ||..::
Zfish   246 GL------WYASKK 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otk2NP_612571.1 IG_like 41..132 CDD:214653 1/4 (25%)
I-set 155..238 CDD:254352 20/94 (21%)
IGc2 175..228 CDD:197706 15/64 (23%)
IG_like 250..331 CDD:214653 25/95 (26%)
IGc2 258..323 CDD:197706 22/74 (30%)
f11r.1NP_001004667.1 Ig 22..119 CDD:299845 24/116 (21%)
IG_like 25..118 CDD:214653 24/112 (21%)
IG_like 130..210 CDD:214653 23/82 (28%)
Ig 139..210 CDD:143165 22/73 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.