Sequence 1: | NP_612571.1 | Gene: | otk2 / 36284 | FlyBaseID: | FBgn0267728 | Length: | 433 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001024582.1 | Gene: | him-4 / 181187 | WormBaseID: | WBGene00001863 | Length: | 5198 | Species: | Caenorhabditis elegans |
Alignment Length: | 283 | Identity: | 75/283 - (26%) |
---|---|---|---|
Similarity: | 122/283 - (43%) | Gaps: | 38/283 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 77 SKTLRQVELGRMDSTTSEPQLETMLREDSRVALSKDSGALQFTSVLASDAGQYQCQLVIDDSVAA 141
Fly 142 SSSSGV-----LLVIEQLKFVPQPTSKNLELGTLSKVHCKAQGTPAPQVKWMRETQLPLPVNV-- 199
Fly 200 --TDQNGTLIFNQVSNEQRGQYTCIASNSQGQITATVSINVVVAPKFSVPPEGPIEVAEAGTAVI 262
Fly 263 HCQAIGEPKPTIQWDKDLTYLNENNTDPERFSLMENGTLEIRNVRPEDEGRYGCTIGSSAGLKRE 327
Fly 328 DVLLVLKSSKSASNSIVTRIIIV 350 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
otk2 | NP_612571.1 | IG_like | 41..132 | CDD:214653 | 12/54 (22%) |
I-set | 155..238 | CDD:254352 | 22/86 (26%) | ||
IGc2 | 175..228 | CDD:197706 | 19/56 (34%) | ||
IG_like | 250..331 | CDD:214653 | 27/80 (34%) | ||
IGc2 | 258..323 | CDD:197706 | 24/64 (38%) | ||
him-4 | NP_001024582.1 | IG_like | 442..515 | CDD:214653 | |
IG | 527..605 | CDD:214652 | |||
Ig | 628..694 | CDD:319273 | |||
I-set | 702..789 | CDD:369462 | |||
I-set | 793..881 | CDD:369462 | |||
Ig | 899..974 | CDD:386229 | |||
I-set | 1012..1081 | CDD:369462 | |||
Ig | 1109..1172 | CDD:319273 | |||
Ig | 1196..1263 | CDD:319273 | |||
IG_like | 1277..1358 | CDD:214653 | |||
I-set | 1373..1450 | CDD:369462 | |||
Ig | 1474..1544 | CDD:386229 | |||
IGc2 | 1563..1628 | CDD:197706 | |||
Ig | 1651..1732 | CDD:386229 | |||
Ig | 1755..1818 | CDD:319273 | |||
Ig | 1839..1912 | CDD:386229 | |||
Ig | 1930..2002 | CDD:386229 | |||
IG_like | 2014..2095 | CDD:214653 | |||
Ig | 2094..2182 | CDD:386229 | |||
Ig | 2190..2283 | CDD:386229 | |||
I-set | 2296..2380 | CDD:369462 | |||
Ig | 2384..2471 | CDD:386229 | |||
IGc2 | 2492..2556 | CDD:197706 | |||
Ig | 2580..2654 | CDD:386229 | |||
Ig | 2686..2753 | CDD:319273 | |||
IG_like | 2768..2850 | CDD:214653 | |||
I-set | 2854..2939 | CDD:369462 | |||
IG_like | 2951..3031 | CDD:214653 | |||
I-set | 3046..3116 | CDD:369462 | |||
I-set | 3127..3213 | CDD:369462 | |||
Ig | 3217..3292 | CDD:386229 | |||
I-set | 3300..3386 | CDD:369462 | |||
I-set | 3396..3472 | CDD:369462 | |||
I-set | 3481..3569 | CDD:369462 | |||
I-set | 3591..3663 | CDD:369462 | |||
Ig | 3667..3762 | CDD:386229 | |||
Ig | 3775..3848 | CDD:386229 | |||
Ig | 3859..3947 | CDD:386229 | |||
IGc2 | 3968..4031 | CDD:197706 | |||
Ig_3 | 4045..4119 | CDD:372822 | |||
Ig_3 | 4136..4210 | CDD:372822 | |||
Ig | <4262..4314 | CDD:386229 | 12/58 (21%) | ||
Ig | 4318..4406 | CDD:386229 | 22/87 (25%) | ||
IG_like | 4418..4496 | CDD:214653 | 30/98 (31%) | ||
I-set | 4570..4654 | CDD:369462 | |||
I-set | 4752..4836 | CDD:369462 | |||
EGF_CA | 4996..5027 | CDD:238011 | |||
EGF_CA | 5034..5076 | CDD:214542 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 53 | 1.000 | Domainoid score | I7606 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |