DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otk2 and zig-12

DIOPT Version :9

Sequence 1:NP_612571.1 Gene:otk2 / 36284 FlyBaseID:FBgn0267728 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_509485.1 Gene:zig-12 / 181123 WormBaseID:WBGene00019727 Length:197 Species:Caenorhabditis elegans


Alignment Length:175 Identity:34/175 - (19%)
Similarity:74/175 - (42%) Gaps:27/175 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 GTPAPQVKW------MRETQLPLPVNVTDQNG--TLIFNQVSNEQR---GQYTCIASNSQGQITA 232
            |....:::|      :.|.:. |..:.:|:.|  |....::.:..:   |:|..:.:|:.|:.::
 Worm    27 GADVSKIQWFFGPDELEENEF-LKFSNSDEGGNRTKFVAEIKDFDKPLAGEYKAVFANADGENSS 90

  Fly   233 TVSINVVVAPKFSVPPEGPIEVAEAGTAVIHCQAIGEPKPTIQWDKD----------LTYLNENN 287
            ..::....||.|...|. .::.......||..:|....:...:|.||          ...:.:::
 Worm    91 NFTVAAGNAPDFHDKPH-IVQRDNGNVIVIKVRAKSHLEMKAEWFKDEKPVKFTDRVKAVVKKDD 154

  Fly   288 TDPERFSLMENGTLEIRNVRPEDEGRYGCTIGSSAGLKREDVLLV 332
            .|.:.|..:    |||...:.:||.:|.|.:.:|.|..::.:.||
 Worm   155 KDKDGFQFL----LEITGPQKDDEAKYKCVVKNSEGQNQQALNLV 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otk2NP_612571.1 IG_like 41..132 CDD:214653
I-set 155..238 CDD:254352 11/69 (16%)
IGc2 175..228 CDD:197706 10/59 (17%)
IG_like 250..331 CDD:214653 17/90 (19%)
IGc2 258..323 CDD:197706 16/74 (22%)
zig-12NP_509485.1 PHA03273 <39..>143 CDD:223031 19/105 (18%)
Ig 100..194 CDD:386229 20/98 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4475
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.