DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otk2 and F11r

DIOPT Version :9

Sequence 1:NP_612571.1 Gene:otk2 / 36284 FlyBaseID:FBgn0267728 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_446248.1 Gene:F11r / 116479 RGDID:621842 Length:300 Species:Rattus norvegicus


Alignment Length:234 Identity:58/234 - (24%)
Similarity:92/234 - (39%) Gaps:48/234 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 KVHCKAQGTPAPQVKWM-------------RETQLPLPVNVTDQNGTLIFNQVSNEQRGQYTCIA 223
            |:.|...|..:|:|:|.             .:..:|....||..:..:.|:.|:.:..|:|||:.
  Rat    46 KLPCIYSGFSSPRVEWKFVQGSTTALVCYNNQITVPYADRVTFSSSGITFSSVTRKDNGEYTCMV 110

  Fly   224 SNSQGQITATVSINVVVAPKFSVPPEGPI-----EVAEAGTAVIHC-QAIGEPKPTIQWDKD--- 279
            |...||....|||::.|.    |||..|.     .|.....||:.| :..|.|.....|.||   
  Rat   111 SEDGGQNYGEVSIHLTVL
----VPPSKPTVSIPSSVTIGNRAVLTCSEHDGSPPSEYSWFKDGVP 171

  Fly   280 -LT--------YLNENNT-DPERFSLMENGTLEIRNVRPEDEGRYGCTIGSSAGLKREDVLLVLK 334
             ||        ::|.:.| ||      ::|.|....|...|.|.|.|...:..|.......:.::
  Rat   172 MLTADAKKTRAFINSSYTIDP------KSGDLVFDPVSAFDSGEYYCEAQNGYGTAMRSEAVRME 230

  Fly   335 SSKSASNSIVTRIIIVIICLAFLYFVLVLGLKVWYRYRR 373
            :.:.....||..:::.:|.|..|.|      .:|:.|.|
  Rat   231 AVELNVGGIVAAVLVTLILLGLLIF------GIWFAYSR 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otk2NP_612571.1 IG_like 41..132 CDD:214653
I-set 155..238 CDD:254352 21/78 (27%)
IGc2 175..228 CDD:197706 15/65 (23%)
IG_like 250..331 CDD:214653 24/99 (24%)
IGc2 258..323 CDD:197706 21/78 (27%)
F11rNP_446248.1 V-set 33..128 CDD:284989 21/81 (26%)
IG_like 37..127 CDD:214653 21/80 (26%)
Ig 139..229 CDD:299845 23/95 (24%)
IG_like 141..221 CDD:214653 23/85 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.