DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otk2 and si:ch73-380l3.4

DIOPT Version :9

Sequence 1:NP_612571.1 Gene:otk2 / 36284 FlyBaseID:FBgn0267728 Length:433 Species:Drosophila melanogaster
Sequence 2:XP_017206719.1 Gene:si:ch73-380l3.4 / 101885005 ZFINID:ZDB-GENE-131125-97 Length:517 Species:Danio rerio


Alignment Length:399 Identity:84/399 - (21%)
Similarity:150/399 - (37%) Gaps:97/399 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 VSISRGPKSSITIKEQSSLQLPCDYQLPDGYLQKSSVILRWRKDSKTLRQVELGRMDSTTSEPQL 97
            :||..|.|....|....|....|.|.:|       .:||...:.|           |.|..:...
Zfish   147 ISIFGGEKMGDKITVTCSASHTCPYSIP-------RIILNGIEGS-----------DQTNGDCSS 193

  Fly    98 ETMLREDSRVALSKDSGALQFTSVLASDAGQYQCQLVID--DSVAASSSSGVLLVIEQLKFVPQ- 159
            :    ...|:||::       |:|:.::...::|.:..|  .:|.|:.......|.:::...|: 
Zfish   194 D----GQCRIALTR-------TAVVKAENTTFECSVTHDGGTTVTATKRQSSECVHQKITVEPEI 247

  Fly   160 -PTSKNLELGTLSKVH--CKAQGTPAPQVKWMRETQLPLPVNVTDQNGTLI---FNQV------- 211
             ..::.::......|:  |:.:.   |.:.|..|       |:....|:.|   |::|       
Zfish   248 VEVTEGIKQNFTCNVYHSCQREN---PTITWNYE-------NMQVSTGSKIVSGFDRVTYSSISF 302

  Fly   212 --SNEQRG-QYTCIASNSQGQITATVSI-------NVVVAPKFSVPPEGPIEVAEAGTAVIH--C 264
              :.|..| :..|.|..|...|.|:|::       |:.:.|:.:...||   |.:..|..:|  |
Zfish   303 LGTTEDHGKKLKCTAKVSGRNIEASVALRVQCVHRNITIEPEIAEITEG---VEQNFTCTVHHSC 364

  Fly   265 QAIGEPKPTIQWDKDLTYLNENNTDPERFSLMENGTLEIRNVRPEDEG-RYGCTIGSSAGLKRED 328
            |   :..|||.|:.:...::|.......|..:...|:.....: ||.| :..|:...|.|...|.
Zfish   365 Q---KENPTITWNYENMQVSEGRQTLSGFDRVVYSTITFLGAK-EDHGKKLICSAAFSRGNITES 425

  Fly   329 VLL--------VLKSSKSASNSIVTRIIIVIICLAFLYFVLVLGLKVWYRYRRHLGKVQLEDGHV 385
            |:|        |||:         |.:.|:...|.||...::.|:.:.  .|||..|   :...|
Zfish   426 VVLYLQHPILTVLKT---------TGLYILTPSLVFLLACVIAGVIIC--KRRHRSK---DASFV 476

  Fly   386 NGPTDGQEH 394
            :|....:.|
Zfish   477 SGSKPFKPH 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otk2NP_612571.1 IG_like 41..132 CDD:214653 15/90 (17%)
I-set 155..238 CDD:254352 19/106 (18%)
IGc2 175..228 CDD:197706 14/65 (22%)
IG_like 250..331 CDD:214653 21/83 (25%)
IGc2 258..323 CDD:197706 16/67 (24%)
si:ch73-380l3.4XP_017206719.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4475
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.