DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otk2 and si:dkey-238d18.5

DIOPT Version :9

Sequence 1:NP_612571.1 Gene:otk2 / 36284 FlyBaseID:FBgn0267728 Length:433 Species:Drosophila melanogaster
Sequence 2:XP_009290155.2 Gene:si:dkey-238d18.5 / 101884711 ZFINID:ZDB-GENE-131121-374 Length:1111 Species:Danio rerio


Alignment Length:370 Identity:80/370 - (21%)
Similarity:129/370 - (34%) Gaps:110/370 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 DVSISRGPKSSITIKEQSSLQLPC--DYQLPDGYLQKSSVILRWRKDSKTLRQVELGRMDSTTSE 94
            :|.:..||    .:||..|:.|.|  |...|       :....|...:|||.        :..|.
Zfish   794 NVKVVTGP----PVKENESVTLTCSSDSNPP-------ATSYEWFSLNKTLL--------AKGSS 839

  Fly    95 PQLETMLREDSRVALSKDSGALQFTSVLASDAGQYQCQLVIDDSVAASSSS----GVLLVIEQLK 155
            .||         |.:|:.:.|:..|:|               ::...:||.    .||.....:|
Zfish   840 YQL---------VKVSRHTEAISCTAV---------------NTEGRNSSDPHHINVLYPPYNVK 880

  Fly   156 FVPQPTSKNLELGTLSKVHCKAQGT-PAPQVKWMRETQLPLPVNVTDQNGTLIFN----QVSNEQ 215
            .|..|..|..|..||:   |.:... ||...:|.            ..|.||...    |:.|..
Zfish   881 VVTGPPVKENESVTLT---CSSDSNPPATSYEWF------------SLNKTLSAKGSSYQLMNVS 930

  Fly   216 R--GQYTCIASNSQGQITA-TVSINVVVAPKFSVPPEGPIEVAEAGTAVIHCQAIGEPKPTIQW- 276
            |  ...:|.|.|::|:.:: ...:|::..|  .:..|...:  .|.:.|..|.....|...::| 
Zfish   931 RHTEAISCTAINTEGRNSSDPQKLNMLYPP--DIKNESSCQ--SASSTVCVCIVDSNPPSEVKWF 991

  Fly   277 --DKDLTYLNENNTDPERFSLMENGTLEIRNVRPEDEGRYGCTIGSSAGLKREDVLLVLKSSKSA 339
              |...|:|:......:..|:.   |||                   |.|...|.:... :|.|.
Zfish   992 SPDSSKTFLSSRTEIKQSLSIF---TLE-------------------AWLDFPDTVQCF-ASNSV 1033

  Fly   340 SNSIVT-------RIIIVIICLAFLYFVLVLGLKVWYRYRRHLGK 377
            .||.:|       .::.:.:..|....::|:|:.| |..|||.||
Zfish  1034 GNSSITLKAPQNDMVLYIAVVSAVSVLLVVVGILV-YAVRRHCGK 1077

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otk2NP_612571.1 IG_like 41..132 CDD:214653 19/92 (21%)
I-set 155..238 CDD:254352 21/90 (23%)
IGc2 175..228 CDD:197706 13/59 (22%)
IG_like 250..331 CDD:214653 15/83 (18%)
IGc2 258..323 CDD:197706 11/67 (16%)
si:dkey-238d18.5XP_009290155.2 Ig 31..142 CDD:325142
Ig 146..237 CDD:325142
Ig_2 252..323 CDD:316418
Ig 610..691 CDD:325142
Ig 698..786 CDD:325142
Ig_2 801..872 CDD:316418 22/113 (19%)
Ig_3 881..942 CDD:316449 18/75 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.