DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otk2 and si:ch73-380l3.3

DIOPT Version :9

Sequence 1:NP_612571.1 Gene:otk2 / 36284 FlyBaseID:FBgn0267728 Length:433 Species:Drosophila melanogaster
Sequence 2:XP_003200123.2 Gene:si:ch73-380l3.3 / 100537501 ZFINID:ZDB-GENE-131121-27 Length:371 Species:Danio rerio


Alignment Length:268 Identity:50/268 - (18%)
Similarity:89/268 - (33%) Gaps:76/268 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 QGTPAPQVKWMRETQLPLPVNVTDQNG------TLIFNQVSNEQRGQ--YTCIASNSQG------ 228
            :|.|.....|.....:......||..|      :|:...:.....|:  ||.|...:.|      
Zfish    60 EGYPLVYDPWNANEVIEKFRGTTDLYGNSSWDCSLLIRNLEQSHHGEKIYTWIDPENVGWRTYKF 124

  Fly   229 -QITATVSINVVVAPKFSVPP-------EGPIEVAEAGTAVIHCQAIGEPKPTIQWDKDLTYLN- 284
             .:|:|:.::  ..|:   ||       |.|.|     |..:.|.|.    .|..:.|....|| 
Zfish   125 YDVTSTILVD--ARPQ---PPSINIYGGERPGE-----TITVVCSAF----HTCPYSKPNLILNG 175

  Fly   285 ---ENNTDPE-------RFSLMENGTLEIRNVRPEDEGRYGCTIGSSAGLKREDVLLVLKSSKSA 339
               .:..|.|       :.||...|..:..:...|      |::....|     :.:|....|:|
Zfish   176 IEGSDQIDNEHIEGGLWKISLTRTGVAKAESSTTE------CSVTYYGG-----ITVVTMKEKTA 229

  Fly   340 SNSIVT----------RIIIVIIC---LAFLYFVLVLGLKVWYRYRRHLGKVQLEDGHVNGPTDG 391
            ..|::.          .:::.|:.   ..||...::.|. :.|:.|:....:..::.|    |..
Zfish   230 QASVLNEQDPAHSELKNVVVHILAPLLAVFLLTCIIAGF-IIYKRRQQQPLIGAQESH----TQL 289

  Fly   392 QEHDHHEN 399
            :|...|.|
Zfish   290 EERRSHWN 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otk2NP_612571.1 IG_like 41..132 CDD:214653
I-set 155..238 CDD:254352 14/74 (19%)
IGc2 175..228 CDD:197706 11/57 (19%)
IG_like 250..331 CDD:214653 17/91 (19%)
IGc2 258..323 CDD:197706 14/75 (19%)
si:ch73-380l3.3XP_003200123.2 Ig 17..>105 CDD:299845 7/44 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4475
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.