DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otk2 and mxra5

DIOPT Version :10

Sequence 1:NP_612571.1 Gene:otk2 / 36284 FlyBaseID:FBgn0267728 Length:433 Species:Drosophila melanogaster
Sequence 2:XP_002941051.4 Gene:mxra5 / 100495231 XenbaseID:XB-GENE-923372 Length:2851 Species:Xenopus tropicalis


Alignment Length:339 Identity:82/339 - (24%)
Similarity:141/339 - (41%) Gaps:68/339 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RGPKSSITIKEQSSLQLP--CDYQLPDGYLQKSSVILRWRKDSKTLRQVELGRMDSTTSEPQLET 99
            :|.|..||.....||.:|  .|..:|..........:.|.|       |..|.:.|..:..|...
 Frog  1873 QGIKPRITTTGLQSLSVPFETDAVIPCETFGDPKPSITWTK-------VATGAVMSKNTRMQRYE 1930

  Fly   100 MLREDSRVALSKDSGALQFTSVLASDAGQYQCQLVIDDSVAASSSSGV-------LLVIEQLKFV 157
            :|          ::|.|....:...|.|||.|        .|.:..|:       .:|::|.:.:
 Frog  1931 VL----------ENGTLSIQKLQLQDHGQYVC--------TAQNQHGIDKMYVTLTVVVQQPRIL 1977

  Fly   158 -PQPTSKNLELGTLSKVHCKAQGTPAPQVKWM-RETQLPLPVNVTD------QNGTLIFNQVSNE 214
             .:.....:.:|....:.|.|.|.|:..:.|: .:.::...|:.|:      :|||||..:.:..
 Frog  1978 GSRYKDVTVYIGDTISMDCPASGVPSVHISWIFPDRKIIRTVSATESRIMLHENGTLIIKETTFT 2042

  Fly   215 QRGQYTCIASNSQGQITATVSINVVVAPKFSVPP------EGPIEVAEAGTAVIHCQAIGEPKPT 273
            .||.:.|:|||..|..:.||.:::.     ::||      :..|.:....:..|||.|.|.|.|:
 Frog  2043 DRGIFKCVASNVAGADSLTVRLHIA-----ALPPIIKQEKQENITLPHGHSVYIHCSAKGAPSPS 2102

  Fly   274 IQW-------DKDLTYLNENNTDPERFSLMENGTLEIRNVRPEDEGRYGCTIGSSAGLKREDVLL 331
            |:|       .:...::|.|      ..:..||||.||::..:|.|:|.|...:..|..|..::|
 Frog  2103 IRWVLFDGTQVRTSQFVNGN------VFVFPNGTLYIRSLSQKDTGKYECVATNIVGAARRTIML 2161

  Fly   332 VLKSSKSASNSIVT 345
            .:|  |.|||:.:|
 Frog  2162 DVK--KLASNAKIT 2173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otk2NP_612571.1 Ig <98..>131 CDD:472250 7/32 (22%)
Ig strand E 114..118 CDD:409560 2/3 (67%)
Ig_3 155..225 CDD:464046 17/77 (22%)
Ig 249..323 CDD:472250 22/80 (28%)
Ig strand B 260..264 CDD:409544 1/3 (33%)
Ig strand C 273..277 CDD:409544 2/10 (20%)
Ig strand E 299..303 CDD:409544 3/3 (100%)
Ig strand F 313..318 CDD:409544 2/4 (50%)
mxra5XP_002941051.4 LRRNT 44..75 CDD:214470
leucine-rich repeat 55..72 CDD:275380
LRR <72..>245 CDD:443914
leucine-rich repeat 74..97 CDD:275380
leucine-rich repeat 98..121 CDD:275380
leucine-rich repeat 122..145 CDD:275380
leucine-rich repeat 146..169 CDD:275380
leucine-rich repeat 170..201 CDD:275380
leucine-rich repeat 202..225 CDD:275380
LRRCT 234..293 CDD:214507
Ig strand B 510..513 CDD:409353
IG_like 511..584 CDD:214653
Ig strand C 522..526 CDD:409353
Ig strand E 550..554 CDD:409353
Ig strand F 564..569 CDD:409353
IG_like 598..680 CDD:214653
Ig strand B 607..611 CDD:409421
Ig strand C 620..624 CDD:409421
Ig strand E 646..650 CDD:409421
Ig strand F 660..665 CDD:409421
Ig strand G 673..676 CDD:409421
Herpes_BLLF1 <1269..1567 CDD:282904
Ig 1895..1959 CDD:409353 16/88 (18%)
Ig strand B 1895..1899 CDD:409353 0/3 (0%)
Ig strand C 1908..1912 CDD:409353 0/3 (0%)
Ig strand E 1935..1939 CDD:409353 2/3 (67%)
Ig strand F 1949..1954 CDD:409353 3/12 (25%)
Ig 1989..2066 CDD:472250 22/76 (29%)
Ig strand B 1992..1996 CDD:409421 0/3 (0%)
Ig strand C 2005..2009 CDD:409421 0/3 (0%)
Ig strand E 2032..2036 CDD:409421 3/3 (100%)
Ig strand F 2046..2051 CDD:409421 1/4 (25%)
Ig strand G 2059..2062 CDD:409421 0/2 (0%)
Ig 2072..2163 CDD:472250 25/96 (26%)
Ig strand B 2089..2093 CDD:409544 1/3 (33%)
Ig strand C 2102..2107 CDD:409544 2/4 (50%)
Ig strand E 2129..2133 CDD:409544 3/3 (100%)
Ig strand F 2143..2148 CDD:409544 2/4 (50%)
Ig strand G 2156..2159 CDD:409544 1/2 (50%)
Ig 2172..2252 CDD:472250 1/2 (50%)
Ig strand B 2188..2192 CDD:409544
Ig strand C 2201..2205 CDD:409544
Ig strand E 2228..2232 CDD:409544
Ig strand F 2242..2247 CDD:409544
Ig 2279..2365 CDD:472250
Ig strand B 2285..2289 CDD:409421
Ig strand C 2298..2302 CDD:409421
Ig strand E 2331..2335 CDD:409421
Ig strand F 2345..2350 CDD:409421
Ig strand G 2358..2361 CDD:409421
I-set 2382..2459 CDD:400151
Ig strand B 2388..2392 CDD:409561
Ig strand C 2401..2405 CDD:409561
Ig strand E 2425..2429 CDD:409561
Ig strand F 2439..2444 CDD:409561
Ig strand G 2452..2455 CDD:409561
Ig 2475..2559 CDD:472250
Ig strand B 2486..2490 CDD:409421
Ig strand C 2499..2503 CDD:409421
Ig strand E 2525..2529 CDD:409421
Ig strand F 2539..2544 CDD:409421
Ig strand G 2552..2555 CDD:409421
Ig_3 2565..2643 CDD:464046
IG_like 2675..2751 CDD:214653
Ig strand B 2678..2682 CDD:409353
Ig strand C 2691..2695 CDD:409353
Ig strand E 2717..2721 CDD:409353
Ig strand F 2731..2736 CDD:409353
Ig_3 2755..2837 CDD:464046
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.