| Sequence 1: | NP_612571.1 | Gene: | otk2 / 36284 | FlyBaseID: | FBgn0267728 | Length: | 433 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_004916459.1 | Gene: | mag / 100494147 | XenbaseID: | XB-GENE-6462484 | Length: | 625 | Species: | Xenopus tropicalis |
| Alignment Length: | 438 | Identity: | 86/438 - (19%) |
|---|---|---|---|
| Similarity: | 137/438 - (31%) | Gaps: | 145/438 - (33%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 30 FEDVSISRG-----PKSSITIKEQSSLQLPCDYQLPD---------------------------- 61
Fly 62 ----------------GYLQKSSVILRWRKDSKTLR-----QVELGRMDSTTSEPQLETMLREDS 105
Fly 106 RVALSKDSGALQFTSVLASDAGQYQCQLVIDD-------------------SVAAS--SSSGVLL 149
Fly 150 VIEQLKFVPQPTSKNLEL--------------------------------------GTLSKVHCK 176
Fly 177 AQGTPAPQVKWMRETQLPLPVNVTDQNGTLIFNQVSNEQRGQYTCIASNSQGQITATVSINVVVA 241
Fly 242 P-KFSVPPEGPIEVAEAGTAVIHCQAIGEPKPTIQWDKDLTYLNENNTDPERFSLMEN-GTLEIR 304
Fly 305 NVRPEDEGRYGCTIGSSAGLKREDV--------LLVLKSSKSASNSIV 344 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| otk2 | NP_612571.1 | IG_like | 41..132 | CDD:214653 | 17/139 (12%) |
| I-set | 155..238 | CDD:254352 | 25/120 (21%) | ||
| IGc2 | 175..228 | CDD:197706 | 17/52 (33%) | ||
| IG_like | 250..331 | CDD:214653 | 21/89 (24%) | ||
| IGc2 | 258..323 | CDD:197706 | 19/65 (29%) | ||
| mag | XP_004916459.1 | Ig | 23..131 | CDD:416386 | 16/108 (15%) |
| FR1 | 23..47 | CDD:409353 | 5/24 (21%) | ||
| Ig strand A | 23..27 | CDD:409353 | 0/3 (0%) | ||
| Ig strand A' | 30..34 | CDD:409353 | 2/3 (67%) | ||
| Ig strand B | 36..47 | CDD:409353 | 2/10 (20%) | ||
| CDR1 | 48..55 | CDD:409353 | 1/6 (17%) | ||
| FR2 | 56..63 | CDD:409353 | 0/6 (0%) | ||
| Ig strand C | 56..63 | CDD:409353 | 0/6 (0%) | ||
| CDR2 | 64..87 | CDD:409353 | 0/22 (0%) | ||
| Ig strand C' | 74..77 | CDD:409353 | 0/2 (0%) | ||
| FR3 | 88..121 | CDD:409353 | 6/32 (19%) | ||
| Ig strand D | 89..93 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 99..107 | CDD:409353 | 2/7 (29%) | ||
| Ig strand F | 114..122 | CDD:409353 | 1/7 (14%) | ||
| CDR3 | 122..126 | CDD:409353 | 2/3 (67%) | ||
| Ig | 142..236 | CDD:416386 | 14/102 (14%) | ||
| Ig strand A | 142..146 | CDD:409353 | 1/3 (33%) | ||
| Ig strand B | 155..161 | CDD:409353 | 0/5 (0%) | ||
| Ig strand C | 172..177 | CDD:409353 | 0/4 (0%) | ||
| Ig strand E | 201..207 | CDD:409353 | 3/5 (60%) | ||
| Ig strand F | 214..221 | CDD:409353 | 1/6 (17%) | ||
| Ig strand G | 228..236 | CDD:409353 | 0/7 (0%) | ||
| Ig_3 | 241..310 | CDD:404760 | 18/70 (26%) | ||
| Ig strand B | 258..262 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C | 271..275 | CDD:409353 | 1/3 (33%) | ||
| Ig strand E | 289..293 | CDD:409353 | 2/3 (67%) | ||
| Ig strand F | 303..308 | CDD:409353 | 2/4 (50%) | ||
| IG | 335..410 | CDD:214652 | 21/82 (26%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||