DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otk2 and igsf10

DIOPT Version :10

Sequence 1:NP_612571.1 Gene:otk2 / 36284 FlyBaseID:FBgn0267728 Length:433 Species:Drosophila melanogaster
Sequence 2:XP_012819117.2 Gene:igsf10 / 100494018 XenbaseID:XB-GENE-6072998 Length:2884 Species:Xenopus tropicalis


Alignment Length:335 Identity:95/335 - (28%)
Similarity:146/335 - (43%) Gaps:56/335 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SYAAPASFEDVSISRGPKSSITIKEQSSLQLPCDYQLPDGYLQKSSVILRWRKDSKTLRQVELGR 87
            |::...|.....|..|..:|.|:...|...:||:..      ...|..:.|.|       |..|.
 Frog  1895 SFSTQNSRSKPRIIGGKAASFTVLANSDAFIPCEAS------GNPSPTILWTK-------VSSGT 1946

  Fly    88 MDSTTSE-PQLETMLREDSRVALSKDSGALQFTSVLASDAGQYQCQLVIDDSVAASSSSGVLLVI 151
            ..|.|.. .::|..:           :|.|...||...|.|||.|  |.::.:   .|..:|:.:
 Frog  1947 FVSKTRRVNKMEVFM-----------NGTLSIPSVGIQDGGQYLC--VANNQL---GSDRLLVTL 1995

  Fly   152 EQLKFVP---QPTSKNLEL--GTLSKVHCKAQGTPAPQVKW-MRETQLPLPVNVTDQ------NG 204
            ..:.:.|   |..|:.:.:  |....|:|:|:|:|.|.:.| ::...:|...:.:::      :|
 Frog  1996 SVITYPPRILQGRSREITVHSGNSVNVNCQAEGSPFPTITWTLKNETIPFGTSTSNRKIFVQPDG 2060

  Fly   205 TLIFNQVSNEQRGQYTCIASNSQGQITATVSINVVVAPKFSVPPEGPIEVAEAGTAV-IHCQAIG 268
            |||...|:...||.|.|:|:|..|:.|.||.|.|:.||...|..:....:|..|..: |.|.|.|
 Frog  2061 TLIIKDVTVYDRGIYRCLATNLAGEDTFTVRIQVIAAPPVIVEEKRQTVLAGPGENLKIPCTAKG 2125

  Fly   269 EPKPTIQW-------DKDLTYLNENNTDPERFSLMENGTLEIRNVRPEDEGRYGCTIGSSAGLKR 326
            .|:||:.|       .|.|.|:|      .:..|..||||.||||...|.|.|.|...||.|.:|
 Frog  2126 NPQPTVHWVAFDGTKIKPLQYVN------AKLFLFSNGTLYIRNVASTDRGNYECIATSSTGSER 2184

  Fly   327 EDVLLVLKSS 336
            ..|.|:::.|
 Frog  2185 RVVNLIVEQS 2194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otk2NP_612571.1 Ig <98..>131 CDD:472250 9/32 (28%)
Ig strand E 114..118 CDD:409560 2/3 (67%)
Ig_3 155..225 CDD:464046 22/81 (27%)
Ig 249..323 CDD:472250 29/81 (36%)
Ig strand B 260..264 CDD:409544 1/4 (25%)
Ig strand C 273..277 CDD:409544 2/10 (20%)
Ig strand E 299..303 CDD:409544 3/3 (100%)
Ig strand F 313..318 CDD:409544 2/4 (50%)
igsf10XP_012819117.2 leucine-rich repeat 40..59 CDD:275380
LRR <59..>220 CDD:443914
leucine-rich repeat 60..83 CDD:275380
leucine-rich repeat 84..107 CDD:275380
leucine-rich repeat 108..131 CDD:275380
leucine-rich repeat 132..155 CDD:275380
leucine-rich repeat 156..187 CDD:275380
leucine-rich repeat 188..211 CDD:275380
PCC 193..>277 CDD:188093
Ig 477..552 CDD:472250
Ig strand B 490..494 CDD:409353
Ig strand C 503..508 CDD:409353
Ig strand E 531..535 CDD:409353
Ig strand F 545..550 CDD:409353
Ig <590..649 CDD:472250
Ig strand C 601..605 CDD:409353
Ig strand E 625..629 CDD:409353
Ig strand F 639..644 CDD:409353
Herpes_BLLF1 <885..1272 CDD:282904
Ig_3 1904..1984 CDD:464046 25/105 (24%)
Ig 2004..2094 CDD:472250 27/89 (30%)
Ig strand B 2020..2024 CDD:409353 1/3 (33%)
Ig strand C 2033..2037 CDD:409353 0/3 (0%)
Ig strand E 2060..2064 CDD:409353 3/3 (100%)
Ig strand F 2074..2079 CDD:409353 2/4 (50%)
Ig strand G 2087..2090 CDD:409353 1/2 (50%)
Ig_3 2098..2177 CDD:464046 29/84 (35%)
Ig_3 2198..2277 CDD:464046
Ig 2300..2383 CDD:472250
Ig strand C 2326..2330 CDD:409353
Ig strand E 2359..2363 CDD:409353
Ig strand F 2373..2378 CDD:409353
IG_like 2410..2487 CDD:214653
Ig strand B 2416..2420 CDD:409353
Ig strand C 2429..2433 CDD:409353
Ig strand E 2453..2457 CDD:409353
Ig strand F 2467..2472 CDD:409353
Ig strand B 2515..2518 CDD:409353
IG_like 2516..2587 CDD:214653
Ig strand C 2527..2531 CDD:409353
Ig strand E 2553..2557 CDD:409353
Ig strand F 2567..2572 CDD:409353
Ig strand G 2580..2583 CDD:409353
Ig_3 2605..2672 CDD:464046
Ig_3 2688..2767 CDD:464046
Ig_3 2784..2866 CDD:464046
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.