DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otk2 and cntn1

DIOPT Version :10

Sequence 1:NP_612571.1 Gene:otk2 / 36284 FlyBaseID:FBgn0267728 Length:433 Species:Drosophila melanogaster
Sequence 2:XP_002932857.1 Gene:cntn1 / 100487602 XenbaseID:XB-GENE-491714 Length:1005 Species:Xenopus tropicalis


Alignment Length:397 Identity:85/397 - (21%)
Similarity:146/397 - (36%) Gaps:101/397 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 ILRWRKDSKTLRQVELGRMDSTTSEPQLETMLREDSRVALSKDSGALQFTSVLASDAGQYQCQLV 134
            ::.|||.::.:                       .:...:|.....|:..::...|.|.|:|:. 
 Frog   258 VITWRKTNEAM-----------------------PASAEISMSGAVLKIFNIQPEDEGTYECEA- 298

  Fly   135 IDDSVAASSSSGVLLVIEQL-KFVPQPTSKNLELGTLSKVH--CKAQGTPAPQVKWMRETQLPLP 196
              .::....:....:.:|.: ::|........::|  |.:|  |.|:|.|.|.::|::.      
 Frog   299 --KNIKGMDTHKAYVYVEGVPEWVEHINDTERDIG--SDLHWACVAKGKPQPSIRWLKN------ 353

  Fly   197 VNVTDQNGTLIFNQVSNEQRGQYTCIASNSQGQITATVSINVV-VAPKFS-VPPEGPIEVAEAGT 259
             ..:...|.||...::.|..|.|.|||.|..|.|.|...:.:: :||.|. .|....:..|:.|.
 Frog   354 -GASYGKGDLIKRGLTLEDAGMYQCIAENMHGIIYANAELKILALAPTFEFTPMRKKVLAAKGGR 417

  Fly   260 AVIHCQAIGEPKPTIQWDKDLTYLNENNTDPERFSLMENGTLEIRNVRPEDEGRYGCTIGSSAG- 323
            .:|.|:....||....|.|....|    .:..|.|:.::|:|||.|:...|||.|.|...:..| 
 Frog   418 VIIECKPKAAPKAKFSWSKGTELL----INSSRVSIWDDGSLEILNITKLDEGSYTCFAENDRGK 478

  Fly   324 LKREDVLLVLKSSK---SASNSIVTRIIIVIICLAFLYFVLVLGLKVWYRYRRHLGK---VQLED 382
            .....||.|..::|   :.||:.||                             :|:   :|...
 Frog   479 ANSTGVLSVTAATKITLAPSNADVT-----------------------------VGENATMQCHA 514

  Fly   383 GH-----------VNG-PTDGQEHDHHENEPCLTEANSS---KNLKSK------LRESTILEQES 426
            .|           :|| |.:..:.|.|.......:..|.   ||.:.|      ....||::..|
 Frog   515 SHDPTLDLTFIWTLNGFPIEFDKEDGHYERAIRNDVGSELVIKNAQLKHAGRYTCTAQTIVDNSS 579

  Fly   427 QVADDIV 433
            ..||.:|
 Frog   580 ASADLVV 586

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otk2NP_612571.1 Ig <98..>131 CDD:472250 5/32 (16%)
Ig strand E 114..118 CDD:409560 1/3 (33%)
Ig_3 155..225 CDD:464046 19/71 (27%)
Ig 249..323 CDD:472250 21/73 (29%)
Ig strand B 260..264 CDD:409544 1/3 (33%)
Ig strand C 273..277 CDD:409544 0/3 (0%)
Ig strand E 299..303 CDD:409544 2/3 (67%)
Ig strand F 313..318 CDD:409544 2/4 (50%)
cntn1XP_002932857.1 Ig 24..118 CDD:472250
Ig strand B 45..49 CDD:409353
Ig strand C 58..62 CDD:409353
Ig strand E 80..84 CDD:409353
Ig strand F 95..100 CDD:409353
Ig strand G 109..112 CDD:409353
Ig2_Contactin-2-like 126..214 CDD:409392
Ig strand A 128..133 CDD:409392
Ig strand B 137..143 CDD:409392
Ig strand C 152..158 CDD:409392
Ig strand C' 163..165 CDD:409392
Ig strand D 170..175 CDD:409392
Ig strand E 178..182 CDD:409392
Ig strand F 192..200 CDD:409392
Ig strand G 202..214 CDD:409392
Ig 227..314 CDD:472250 9/81 (11%)
Ig strand B 245..249 CDD:409353
Ig strand C 258..262 CDD:409353 0/3 (0%)
Ig strand E 279..283 CDD:409353 1/3 (33%)
Ig strand F 293..298 CDD:409353 2/4 (50%)
Ig strand G 306..309 CDD:409353 0/2 (0%)
Ig 318..394 CDD:472250 23/84 (27%)
Ig strand B 334..338 CDD:409353 1/3 (33%)
Ig strand C 347..351 CDD:409353 0/3 (0%)
Ig strand E 360..364 CDD:409353 2/3 (67%)
Ig strand F 374..379 CDD:409353 2/4 (50%)
Ig strand G 387..390 CDD:409353 1/2 (50%)
Ig 399..487 CDD:472250 27/91 (30%)
Ig strand B 418..422 CDD:409353 1/3 (33%)
Ig strand C 431..435 CDD:409353 0/3 (0%)
Ig strand E 453..457 CDD:409353 2/3 (67%)
Ig strand F 467..472 CDD:409353 2/4 (50%)
Ig strand G 480..483 CDD:409353 0/2 (0%)
Ig6_Contactin 490..584 CDD:409359 21/122 (17%)
Ig strand A 490..495 CDD:409359 1/4 (25%)
Ig strand A' 498..503 CDD:409359 2/4 (50%)
Ig strand B 506..514 CDD:409359 1/7 (14%)
Ig strand C 523..527 CDD:409359 0/3 (0%)
Ig strand D 548..551 CDD:409359 0/2 (0%)
Ig strand E 552..556 CDD:409359 1/3 (33%)
Ig strand F 565..572 CDD:409359 0/6 (0%)
Ig strand G 579..583 CDD:409359 1/3 (33%)
FN3 596..687 CDD:238020
FN3 <663..>931 CDD:442628
FN3 909..972 CDD:238020
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.