DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otk2 and vsig10l

DIOPT Version :9

Sequence 1:NP_612571.1 Gene:otk2 / 36284 FlyBaseID:FBgn0267728 Length:433 Species:Drosophila melanogaster
Sequence 2:XP_009290965.1 Gene:vsig10l / 100333975 ZFINID:ZDB-GENE-131127-231 Length:680 Species:Danio rerio


Alignment Length:262 Identity:58/262 - (22%)
Similarity:104/262 - (39%) Gaps:41/262 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 SRVALSKDSGALQFTSVLASDAGQYQCQL--VIDDSVAASSSSGVLLVIEQLKFVPQPTSKNLEL 167
            |.|..::..|:|.|.:|.....|.|..::  :.:..|:|:..   |.:.:.:        .|:.|
Zfish    87 SGVLKAEQDGSLTFRNVSMIYNGTYTVEMNKIGEAKVSATFD---LFI
YDLI--------MNVSL 140

  Fly   168 GT-----------LSKVHCKAQGTPAPQVKWM-RETQLPLPVNVTDQNGTLIFNQVSNEQRGQYT 220
            .|           .|..:...|| .|.:|:|: ...|:....:.:.....|...|.|....|:||
Zfish   141 HTDSDDAIEGEVKFSLYYSTIQG-EAKEVQWLFNGLQIKDGSHYSISGKRLTIKQPSRNDTGRYT 204

  Fly   221 CIASNSQGQITATVSINVVVAPKFSVPPEGPIE-VAEAGTAV-IHCQAIGEPKPTIQWDKDLTYL 283
            .:.:|.........:|.|:..|...:....|.: |..:|.:: :.|||.|||.|:..|    |: 
Zfish   205 VLLTNPFSSEDHHRNITVLYGPDMPLLKVSPTKAVFVSGESLFLSCQADGEPAPSNTW----TF- 264

  Fly   284 NENNTDPERFSLMENGTLEIRNVRPEDEGRYGCTIGSS---AGLKREDVLLVLKSSKSASNSIVT 345
                 :.|.......||:.:.:|:....|.|.|.:.:|   |.|:|...::|.:|...|....|.
Zfish   265 -----NGESIPAFSPGTVSLTDVKTNQSGVYTCLMINSRTNAALQRNITVIVYESPSGAPQCSVQ 324

  Fly   346 RI 347
            .:
Zfish   325 TV 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otk2NP_612571.1 IG_like 41..132 CDD:214653 8/26 (31%)
I-set 155..238 CDD:254352 18/94 (19%)
IGc2 175..228 CDD:197706 13/53 (25%)
IG_like 250..331 CDD:214653 23/85 (27%)
IGc2 258..323 CDD:197706 18/68 (26%)
vsig10lXP_009290965.1 Ig 46..131 CDD:299845 11/46 (24%)
Ig 167..223 CDD:299845 11/55 (20%)
IG_like 235..311 CDD:214653 23/85 (27%)
IGc2 242..293 CDD:197706 16/60 (27%)
Ig 413..478 CDD:299845
FN3 496..583 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4475
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.