DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otk2 and ptk7b

DIOPT Version :9

Sequence 1:NP_612571.1 Gene:otk2 / 36284 FlyBaseID:FBgn0267728 Length:433 Species:Drosophila melanogaster
Sequence 2:XP_021336598.1 Gene:ptk7b / 100150035 ZFINID:ZDB-GENE-101124-3 Length:414 Species:Danio rerio


Alignment Length:117 Identity:27/117 - (23%)
Similarity:46/117 - (39%) Gaps:25/117 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   329 VLLVLKSSKSA--------SNSIVTRIIIVIICLAFLYFVLVLGLKVWYRYR---RHLGK----V 378
            |.:.:.|.|.|        |...:.:.:.:.:.:|..|.:.:|||..:.:.|   ||..|    .
Zfish    25 VCVCVSSEKPAPRDEDEDKSQFKLFQTVALSVAVAVAYMMAMLGLMFYCKQRRRSRHTQKTHTAA 89

  Fly   379 QLEDGHVNGPTDGQEHDHHENEPCLTEANSSKNLKSKLRESTILEQESQVAD 430
            :.|...:|.|.:|......:.|..||:          ||.|...|:|...:|
Zfish    90 EAETECLNVPLNGHRVAGLQEEVALTD----------LRASADPEKEQSCSD 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otk2NP_612571.1 IG_like 41..132 CDD:214653
I-set 155..238 CDD:254352
IGc2 175..228 CDD:197706
IG_like 250..331 CDD:214653 1/1 (100%)
IGc2 258..323 CDD:197706
ptk7bXP_021336598.1 PKc_like 135..407 CDD:328722
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D245153at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.