DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otk2 and jam2b

DIOPT Version :9

Sequence 1:NP_612571.1 Gene:otk2 / 36284 FlyBaseID:FBgn0267728 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_001121766.1 Gene:jam2b / 100005301 ZFINID:ZDB-GENE-080229-3 Length:306 Species:Danio rerio


Alignment Length:306 Identity:70/306 - (22%)
Similarity:119/306 - (38%) Gaps:77/306 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 SFEDVSISRGPKSSITIKEQSSLQLPCDYQLPDGYLQKSSVILRWRKDSKTLRQVELGRMDSTTS 93
            |.:.|:::.. |:.:.:.|.::..|.|:::..    ::::..:.|:|..|.:..|.. ..|.|.|
Zfish    29 SSDPVTVTTS-KAKMDVHENTNAVLSCEFRTE----KETNPRVEWKKRGKDVSYVYF-EGDFTGS 87

  Fly    94 EPQLETMLREDSRVALSKDSGALQFTSVLASDAGQYQCQLVI-DDSVAASSSSGVLLVIEQLKFV 157
                       .:...|.|...|....|...|:|.|.|::.. .|.:.....|..|.|:     |
Zfish    88 -----------YKGRASIDGATLTLRGVTQKDSGVYHCEVTARQDKIKLGEVSVTLSVL-----V 136

  Fly   158 P--QPTSKNLEL---GTLSKVHCKAQ-GTPAPQVKWMRETQLPLPVNVTD----------QNGTL 206
            |  .||.:..|.   |..:::|||.: ..||....|.::.:   |:|..:          :.|:|
Zfish   137 PPHAPTCEVPEAVMRGFSAELHCKDKLSVPAATYSWYKDNK---PLNTANPHDVHYTLDTKTGSL 198

  Fly   207 IFNQVSNEQRGQYTCIASNSQG----------QITA-TVSINVVVAPKFSVPPEGPIEVAEAGTA 260
            .|..||....|||.|.|||..|          :||. .:::.:::|          |||......
Zfish   199 KFKSVSKSDEGQYRCEASNGVGAPKSCAGHHMKITEFELNMTMIIA----------IEVGAFLLL 253

  Fly   261 VIHCQAI-------------GEPKPTIQWDKDLTYLNENNTDPERF 293
            |..|.:|             .:.|..|:..|..|..|: .|||.|:
Zfish   254 VSCCVSICLCCRRGCCHCCRRQSKEEIKQSKTKTSYNQ-PTDPRRY 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otk2NP_612571.1 IG_like 41..132 CDD:214653 17/90 (19%)
I-set 155..238 CDD:254352 29/109 (27%)
IGc2 175..228 CDD:197706 19/63 (30%)
IG_like 250..331 CDD:214653 15/57 (26%)
IGc2 258..323 CDD:197706 12/49 (24%)
jam2bNP_001121766.1 Ig 44..135 CDD:299845 21/106 (20%)
IG_like 44..134 CDD:214653 21/105 (20%)
IGc2 154..220 CDD:197706 20/68 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.