DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otk2 and si:ch73-380l3.2

DIOPT Version :9

Sequence 1:NP_612571.1 Gene:otk2 / 36284 FlyBaseID:FBgn0267728 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_001348166.1 Gene:si:ch73-380l3.2 / 100003913 ZFINID:ZDB-GENE-080303-1 Length:266 Species:Danio rerio


Alignment Length:348 Identity:67/348 - (19%)
Similarity:110/348 - (31%) Gaps:140/348 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GLGFFCL-IFCSYAAPASFEDVSISRGPKSSITIKEQSSLQLPCDYQLPDGYLQKSSVILR--WR 74
            |:..||| :.|:... |....|.:....|:.::    |.:.|||::..|....|:.|..:|  |.
Zfish     6 GVFLFCLHVLCAVVL-ADVWKVDVEHKMKALVS----SCVVLPCNFTYPVHQQQQPSYRIRGIWH 65

  Fly    75 KDSKTLRQVELGRMDSTTSEPQLETMLREDSRVALSKDSGALQFTSVLASDAGQYQCQLVIDDSV 139
            |.:|....:..|  |.|..|...:...|                   |....|.:.|.|.||:  
Zfish    66 KMNKWDDIIFYG--DKTLVEDNFKGRTR-------------------LIGSLGSFNCSLEIDE-- 107

  Fly   140 AASSSSGVLLVIEQLKFVPQPTSKNLELGTLSKVHCKAQGTPAPQVKWMRETQLPLPVNVTDQNG 204
            ..::.:|             |....:||.|            ||:.|                  
Zfish   108 VKNTDNG-------------PYCFRVELET------------APKDK------------------ 129

  Fly   205 TLIFNQVSNEQRGQYTCIASNSQGQITATVSINVVVAPKFSVPPEGPIEVAEAGTAVIHCQAIGE 269
               ::.|.|       |            |||..:        .|.|..:.||.|:|:.    ||
Zfish   130 ---YSFVDN-------C------------VSITTI--------EEAPKPMLEAETSVLE----GE 160

  Fly   270 P--------------KPTIQWDKDLTYLNENNTDPERFSLMENGTLEIRNV---RPEDEGRY--- 314
            |              :|:..|::....::..|.       :.:|..|..::   .|..|..|   
Zfish   161 PAIFKCSVRHTCPTYQPSFSWNRAGKIISSYND-------LGHGNWEAESLLTFTPTKEDNYTSI 218

  Fly   315 GCTIGSSAGLKREDVLLVLKSSK 337
            .||:.....:|.|     :|:|:
Zfish   219 ECTVKYHGNVKGE-----MKASR 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otk2NP_612571.1 IG_like 41..132 CDD:214653 18/92 (20%)
I-set 155..238 CDD:254352 13/82 (16%)
IGc2 175..228 CDD:197706 6/52 (12%)
IG_like 250..331 CDD:214653 20/100 (20%)
IGc2 258..323 CDD:197706 15/84 (18%)
si:ch73-380l3.2NP_001348166.1 Ig 24..141 CDD:325142 38/208 (18%)
Ig 148..226 CDD:325142 17/88 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4475
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.