DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otk and IL1RL1

DIOPT Version :9

Sequence 1:NP_523705.2 Gene:otk / 36283 FlyBaseID:FBgn0004839 Length:1033 Species:Drosophila melanogaster
Sequence 2:NP_057316.3 Gene:IL1RL1 / 9173 HGNCID:5998 Length:556 Species:Homo sapiens


Alignment Length:191 Identity:56/191 - (29%)
Similarity:78/191 - (40%) Gaps:39/191 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   378 KFVPQPTSKNLELDAVVAKVHCKAQGTPTPQVQWVRDGENTTLP--DHVEVDANGTLI-FRNVNS 439
            ||..|  |..||.:|::  |.|..||.|:..|.|.....|.::|  :...|.|:|.|: |.....
Human    19 KFSKQ--SWGLENEALI--VRCPRQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAV 79

  Fly   440 EHRGNYTCLATNSQGQINATVAINVVVTPKFS---VPP---VGPIETSEQGTVVMHCQAIGDPKP 498
            ...|.|||:..:.  ..|.|...||.:..|.|   ||.   ...:..||:.:.: :|       |
Human    80 ADSGIYTCIVRSP--TFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKI-YC-------P 134

  Fly   499 TI---------QWDKDLKYLSENNTDRERFRFLENGTLEIRNVQVEDEGSYGCT-IGNSAG 549
            ||         :|.|:.:.|..:     |:| .....|.|.||..||.|.|.|. |.|..|
Human   135 TIDLYNWTAPLEWFKNCQALQGS-----RYR-AHKSFLVIDNVMTEDAGDYTCKFIHNENG 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otkNP_523705.2 I-set 26..115 CDD:254352
Ig 31..115 CDD:299845
IGc2 133..195 CDD:197706
Ig 268..373 CDD:299845
Ig 395..460 CDD:143165 19/67 (28%)
I-set 468..559 CDD:254352 27/98 (28%)
IGc2 484..549 CDD:197706 20/74 (27%)
PTK_CCK4 686..1026 CDD:133178
STYKc 692..1020 CDD:214568
IL1RL1NP_057316.3 Ig 16..104 CDD:299845 29/90 (32%)
IG_like 21..104 CDD:214653 27/88 (31%)
Ig2_IL1R_like 118..204 CDD:143234 23/86 (27%)
IG_like 120..197 CDD:214653 23/84 (27%)
Flexible linker 198..211
TIR 380..535 CDD:279864
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.