DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otk and IL18R1

DIOPT Version :9

Sequence 1:NP_523705.2 Gene:otk / 36283 FlyBaseID:FBgn0004839 Length:1033 Species:Drosophila melanogaster
Sequence 2:NP_003846.1 Gene:IL18R1 / 8809 HGNCID:5988 Length:541 Species:Homo sapiens


Alignment Length:405 Identity:86/405 - (21%)
Similarity:152/405 - (37%) Gaps:105/405 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 IKEGEPTALT-CLYELPDELKNQRIQLRWRKDGKLLRQVELGGSAPIPGHSFDSGKDALLREDAR 329
            :.||||..|. |...|..|:  :.....|.|.......|||..                 |..:|
Human    30 VVEGEPFYLKHCSCSLAHEI--ETTTKSWYKSSGSQEHVELNP-----------------RSSSR 75

  Fly   330 LVLHKQNGTLSFASIIASDAGQYQCQ------------LQLEAHAPINSSPGILEVIEQLKFVPQ 382
            :.||  :..|.|..:..:|.|.|..|            ::...|:.........:::|..||. |
Human    76 IALH--DCVLEFWPVELNDTGSYFFQMKNYTQKWKLNVIRRNKHSCFTERQVTSKIVEVKKFF-Q 137

  Fly   383 PTSKNLELDAVVAKV----HCKAQGTPTPQVQWVRDGENTTLPDHVEVDANGTLIFRNVNSEHRG 443
            .|.:|.....:|...    :||.        ..:.:.:|.|             |.:|...|.:|
Human   138 ITCENSYYQTLVNSTSLYKNCKK--------LLLENNKNPT-------------IKKNAEFEDQG 181

  Fly   444 NYTCL-ATNSQGQI-NATVAINV-VVTPKFSVPPV--GP------IETSEQGTVVMHCQAIGDPK 497
            .|:|: ..:..|:: |.|...|: :|..:.::.||  ||      :|..:  .|.::|.|:.:.:
Human   182 YYSCVHFLHHNGKLFNITKTFNITIVEDRSNIVPVLLGPKLNHVAVELGK--NVRLNCSALLNEE 244

  Fly   498 PTIQWDKDLKYLSENNTD-----RERFRFL--ENGTLEIRNVQVEDEGS------YGCTIGNSAG 549
            ..|.|    .:..||.:|     .:..|.:  |......:.:::|:.|.      |.||:.::.|
Human   245 DVIYW----MFGEENGSDPNIHEEKEMRIMTPEGKWHASKVLRIENIGESNLNVLYNCTVASTGG 305

  Fly   550 LKREDVQLVVKTTGDGFAPEESGGDGFLVTRAVLITMTVALAYIVLV-------VGLMLWCRYRR 607
            ...:...||.|.       :.:...|.:.||.::|.:.:.:|.:.||       |.|:|:.|:..
Human   306 TDTKSFILVRKA-------DMADIPGHVFTRGMIIAVLILVAVVCLVTVCVIYRVDLVLFYRHLT 363

  Fly   608 QARKARLNDLSTKEA 622
            : |...|.|..|.:|
Human   364 R-RDETLTDGKTYDA 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otkNP_523705.2 I-set 26..115 CDD:254352
Ig 31..115 CDD:299845
IGc2 133..195 CDD:197706
Ig 268..373 CDD:299845 24/117 (21%)
Ig 395..460 CDD:143165 12/70 (17%)
I-set 468..559 CDD:254352 22/111 (20%)
IGc2 484..549 CDD:197706 15/77 (19%)
PTK_CCK4 686..1026 CDD:133178
STYKc 692..1020 CDD:214568
IL18R1NP_003846.1 Ig 28..100 CDD:325142 22/90 (24%)
Ig 129..208 CDD:325142 21/100 (21%)
PHA02785 <171..312 CDD:333475 32/146 (22%)
TIR 378..520 CDD:307630 86/405 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.