DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otk and SKM1

DIOPT Version :9

Sequence 1:NP_523705.2 Gene:otk / 36283 FlyBaseID:FBgn0004839 Length:1033 Species:Drosophila melanogaster
Sequence 2:NP_014528.1 Gene:SKM1 / 854036 SGDID:S000005473 Length:655 Species:Saccharomyces cerevisiae


Alignment Length:450 Identity:89/450 - (19%)
Similarity:172/450 - (38%) Gaps:111/450 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   604 RYRRQAR----KARLNDLSTKEAGGDQPDVAGNGKGSEQEPCLS--KQHNGHS---KSRSKSSGD 659
            :.|.:.|    |....|..||:.|           ..||:...|  ::|:.:|   ..|...|..
Yeast   262 KVREEGRVHVSKESTADSQTKQLG-----------KKEQKVIQSHLRRHDNNSTFRPHRLAPSAP 315

  Fly   660 AQKSDDTACSQQSRASKKSAHIYEQLALPRSGLSELIQIGRGEFGDVFVGKLKATLV-TSPSDKD 723
            |.|:.|         ||...|           ..:|:::...:..:..:.|:|...: .:|....
Yeast   316 ATKNHD---------SKTKWH-----------KEDLLELKNNDDSNEIIMKMKTVAIDVNPRPYF 360

  Fly   724 ADTEKQHSNSENGSGGSGSGSTTLSTLNEKRRSKTSMDDIEEIKEEEQDQHNQSGLEQLVLVKAL 788
            ...||        :|...||:..||    ||......:|...:|     .|....:.:.|.:|.:
Yeast   361 QLVEK--------AGQGASGAVYLS----KRIKLPQENDPRFLK-----SHCHRVVGERVAIKQI 408

  Fly   789 NKVKDEQACQEFRRQLDLLRAISHKGVVR-LFGLCREKDPHYMVLEYTDWGDLKQFLLATAGKVN 852
             ::.::...|....:|.::.....:.:|. |.....:.:..::::||.:.|.|...|.|.| :.|
Yeast   409 -RLSEQPKKQLIMNELLVMNDSRQENIVNFLEAYIIDDEELWVIMEYMEGGCLTDILDAVA-RSN 471

  Fly   853 TATAGSSSPPPLTTSQVLAVAYQIARGMDAIYRARFTHRDLATRNCVISSEFIVKVSYPALCKDK 917
            |....|    ||..:|:..:..:..:|:..::..:..|||:.:.|.:::|:.:||::....|.: 
Yeast   472 TGEHSS----PLNENQMAYIVKETCQGLKFLHNKKIIHRDIKSDNILLNSQGLVKITDFGFCVE- 531

  Fly   918 YSREYHKHRNTLL--PIRWLAPECIQEDEYTTKSDIFAYGVVVWELF------------------ 962
             ..|....|.|::  |. |:|||.:.:..|..|.|:::.|:::.|:.                  
Yeast   532 -LTEKRSKRATMVGTPY-WMAPEIVNQKGYDEKVDVWSLGIMLIEMIEGEPPYLNEDPLKALYLI 594

  Fly   963 --NQATKLPHEELTNEQVVQRSQAGSLEWSVAEATPDSLREILLSCWVSNPKERPSFSQL 1020
              |.:.||.|.|..::|.                     ::.|.:|...|.:.|.|..:|
Yeast   595 ANNGSPKLRHPESVSKQT---------------------KQFLDACLQVNVESRASVRKL 633

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otkNP_523705.2 I-set 26..115 CDD:254352
Ig 31..115 CDD:299845
IGc2 133..195 CDD:197706
Ig 268..373 CDD:299845
Ig 395..460 CDD:143165
I-set 468..559 CDD:254352
IGc2 484..549 CDD:197706
PTK_CCK4 686..1026 CDD:133178 68/358 (19%)
STYKc 692..1020 CDD:214568 68/351 (19%)
SKM1NP_014528.1 PH_Cla4_Ste20 4..113 CDD:270097
PBD 122..180 CDD:395634
STKc_PAK 359..640 CDD:270789 64/321 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.