DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otk and HERK1

DIOPT Version :9

Sequence 1:NP_523705.2 Gene:otk / 36283 FlyBaseID:FBgn0004839 Length:1033 Species:Drosophila melanogaster
Sequence 2:NP_190214.1 Gene:HERK1 / 823774 AraportID:AT3G46290 Length:830 Species:Arabidopsis thaliana


Alignment Length:719 Identity:161/719 - (22%)
Similarity:267/719 - (37%) Gaps:151/719 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   411 WVR------DGEN---------TTLPDHVEVDANGTLIFRNVNSEHRGNYT-----CLATNSQGQ 455
            |||      |.:|         .:...||.: ::.|:....|..|:..|.|     ...|.|.|.
plant    99 WVRLYFNPFDYQNFKMGSAKFAVSSQSHVLL-SDFTVTSSKVVKEYSLNVTTNDLVLTFTPSSGS 162

  Fly   456 ---INATVAINVVVT-----PKFSVPPVGPIETSEQGTVVMHCQAIGDP-------KPTIQWDKD 505
               :||...|::..|     |:|...|....:.|.||...:|...:|.|       ..|..|..|
plant   163 FAFVNAIEVISIPDTLITGSPRFVGNPAQFPDMSMQGLETIHRVNMGGPLVASNNDTLTRTWVPD 227

  Fly   506 LKYLSENNTDRERFRFLENGTLE-IRNVQVEDEGS---YG-CTIGNSAGLKREDVQLVVKTTGDG 565
            .::|.|.|..:...:|   .|:. :.....||...   || ||..|||    ::...:...|.: 
plant   228 SEFLLEKNLAKSMSKF---STVNFVPGYATEDSAPRTVYGSCTEMNSA----DNPNSIFNVTWE- 284

  Fly   566 FAPEESGGDGFLVTRAVLITMTVALAYIVLVVGLMLWCRYRRQARKARLNDLST----KEAGGDQ 626
            |..:......|......::::::...|..|.|..|:         .|...||||    ..||...
plant   285 FDVDPGFQYYFRFHFCDIVSLSLNQLYFNLYVDSMV---------AATDIDLSTLVDNTLAGAYS 340

  Fly   627 PD-VAGNGKGSEQ-----EPCLSKQHNGHSKS-------RSKSSGDAQKSDDTACSQQSRASKKS 678
            .| |....|||.:     .|  |..|..:..:       ...::...|.|..|.....|.:||.:
plant   341 MDFVTQTPKGSNKVRVSIGP--STVHTDYPNAIVNGLEIMKMNNSKGQLSTGTFVPGSSSSSKSN 403

  Fly   679 AHIYEQLALPRSGLSELIQIGRGEFGDVFVGKLKATLVTSPSDKDADTEKQHSNSENGS--GGSG 741
            ..:     :..|.:..|:.:       ||:|............:|..::.....|.||:  |...
plant   404 LGL-----IVGSAIGSLLAV-------VFLGSCFVLYKKRKRGQDGHSKTWMPFSINGTSMGSKY 456

  Fly   742 SGSTTLSTLNEKRRSKTSMDDIEEIKEEEQDQHN--QSGLEQL----------VLVKALNKVKDE 794
            |..|||:::......:.....:::......:..|  ..|..::          |.||..|. |.:
plant   457 SNGTTLTSITTNANYRIPFAAVKDATNNFDESRNIGVGGFGKVYKGELNDGTKVAVKRGNP-KSQ 520

  Fly   795 QACQEFRRQLDLLRAISHKGVVRLFGLCREKDPHYMVLEYTDWGDLKQFLLATAGKVNTATAGSS 859
            |...|||.::::|....|:.:|.|.|.|.|.:...::.||.:.|.:|..|.            .|
plant   521 QGLAEFRTEIEMLSQFRHRHLVSLIGYCDENNEMILIYEYMENGTVKSHLY------------GS 573

  Fly   860 SPPPLTTSQVLAVAYQIARGMDAIYRA---RFTHRDLATRNCVISSEFIVKVSYPALCKDKYSRE 921
            ..|.||..|.|.:....|||:..::..   ...|||:.:.|.::...|:.||:...|.|.....:
plant   574 GLPSLTWKQRLEICIGAARGLHYLHTGDSKPVIHRDVKSANILLDENFMAKVADFGLSKTGPELD 638

  Fly   922 YHKHRNTLL--PIRWLAPECIQEDEYTTKSDIFAYGVVVWELFNQA----TKLPHEELTN----- 975
             ..|.:|.:  ...:|.||..:..:.|.|||::::|||::|:....    ..|| .|:.|     
plant   639 -QTHVSTAVKGSFGYLDPEYFRRQQLTDKSDVYSFGVVLFEVLCARPVIDPTLP-REMVNLAEWA 701

  Fly   976 ---------EQVVQRSQAGSLEWSVAEATPDSLREILLS---CWVSNPKERPSFSQLGAALSKAM 1028
                     :|::.:|..|::.       |||||:...:   |......:|||...:...|..|:
plant   702 MKWQKKGQLDQIIDQSLRGNIR-------PDSLRKFAETGEKCLADYGVDRPSMGDVLWNLEYAL 759

  Fly  1029 QSAE 1032
            |..|
plant   760 QLQE 763

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otkNP_523705.2 I-set 26..115 CDD:254352
Ig 31..115 CDD:299845
IGc2 133..195 CDD:197706
Ig 268..373 CDD:299845
Ig 395..460 CDD:143165 17/71 (24%)
I-set 468..559 CDD:254352 26/102 (25%)
IGc2 484..549 CDD:197706 20/76 (26%)
PTK_CCK4 686..1026 CDD:133178 85/379 (22%)
STYKc 692..1020 CDD:214568 83/367 (23%)
HERK1NP_190214.1 Malectin_like 33..380 CDD:372329 67/300 (22%)
STKc_IRAK 491..756 CDD:270968 69/286 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 98 1.000 Inparanoid score I2197
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.