DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otk and Musk

DIOPT Version :9

Sequence 1:NP_523705.2 Gene:otk / 36283 FlyBaseID:FBgn0004839 Length:1033 Species:Drosophila melanogaster
Sequence 2:NP_112323.2 Gene:Musk / 81725 RGDID:3211 Length:868 Species:Rattus norvegicus


Alignment Length:1079 Identity:234/1079 - (21%)
Similarity:385/1079 - (35%) Gaps:373/1079 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 TNLASGAREASPPAKLSVIYLES--ASVQLLGSNRNELLLKCHVEGASGDLEPLEIEWYRN---- 156
            |.:|....|..|.|.:....||:  |.|:.:.:      ..|.||...   :| ||.|.||    
  Rat    14 TLVAFSGTEKLPKAPVITTPLETVDALVEEVAT------FMCAVESYP---QP-EISWTRNKILI 68

  Fly   157 ---SEKLSTWKNVQLDQHRLIIRQPGSEDDGLYRCTASNAAGRVMSKQGYVYQSSVKCLPRLPRR 218
               ..:.|..:|.||    |.|......|||:|.|||:|..|..:...|.:   .||..|::.| 
  Rat    69 KLFDTRYSIRENGQL----LTILSVEDSDDGIYCCTANNGVGGAVESCGAL---QVKMKPKITR- 125

  Fly   219 KNEKMMESWDKQTFLCRGKRGGAAGLEALPAAPEDLRIVQGPIGQSIIKEGEPTALTCLYELPDE 283
                                                    .||...|| ||....|.|     ..
  Rat   126 ----------------------------------------PPINVKII-EGLKAVLPC-----TT 144

  Fly   284 LKNQRIQLRWRKDGKLLRQVELGGSAPIPGHSFDSGKDALLREDARLVLHKQNGTLSFASIIASD 348
            :.|.:..:.|.|.                        |:.|||::|:.: .::|:|...::...|
  Rat   145 MGNPKPSVSWIKG------------------------DSALRENSRIAV-LESGSLRIHNVQKED 184

  Fly   349 AGQYQCQLQLEAHAPINSSPGI-------LEVIEQLKFVPQPTSKNLELDAVVAKVHCKAQGTPT 406
            ||||:|..:        :|.|.       |||....:.:..|.|.|:...:.|. :.|.|.|.|.
  Rat   185 AGQYRCVAK--------NSLGTAYSKLVKLEVEVFARILRAPESHNVTFGSFVT-LRCTAIGMPV 240

  Fly   407 PQVQWVRDG---ENTTLPDHVE---VDANGTLIFRNVNSEHRGNYTCLATNSQGQINATVAINVV 465
            |.:.|:.:|   .:.::.::|:   :|:...|....     .|.|||:|||..|:..:|......
  Rat   241 PTISWIENGNAVSSGSIQENVKDRVIDSRLQLFITK-----PGLYTCIATNKHGEKFSTAKAAAT 300

  Fly   466 VTPKFSVPPVGPIETSEQGTVVMH----CQAI-------------GDPKPTIQ------WDKDLK 507
            |    |:......:...:|....:    |.|:             .||:...:      |: :||
  Rat   301 V----SIAEWSKSQKESKGYCAQYRGEVCDAVLVKDSLVFFNTSYPDPEEAQELLIHTAWN-ELK 360

  Fly   508 YLS--------------------------------------------------ENNTDRERFR-- 520
            .:|                                                  |..|.|..:|  
  Rat   361 AVSPLCRPAAEALLCNHLFQECSSGVLPTPMPICREYCLAVKELFCAKEWLAMEGKTHRGLYRSG 425

  Fly   521 --FLENGTLEIRNVQVEDEGSYGCTIGNSAGLKREDVQLVVKTTGDGFAPEESGGD--------- 574
              ||.  ..|...:....:....||.......|:|::     ||.......:...|         
  Rat   426 MHFLP--VPECSKLPSMHQDPTACTRLPYLDYKKENI-----TTFPSITSSKPSVDIPNLPASTS 483

  Fly   575 GFLVTRAVLITMTVAL-----AYIVLVVGLMLWCRYRRQ----ARKARLNDLSTKEAGGDQPDVA 630
            .|.|:.|..:|:.:::     .:.:|.:..:..||.||:    .|::....|:|..:        
  Rat   484 SFAVSPAYSMTVIISIMSCFAVFALLTITTLYCCRRRREWKNKKRESAAVTLTTLPS-------- 540

  Fly   631 GNGKGSEQEPCLSKQHNGHSKSRSKSSGDAQKSDDTACSQQSRASKKSAHIYEQLAL-------- 687
                    |..|.:.|..                               .:|:::.|        
  Rat   541 --------ELLLDRLHPN-------------------------------PMYQRMPLLLNPKLLS 566

  Fly   688 ---PRSGLSELIQIGRGEFGDVFVGKLKATLVTSPSDKDADTEKQHSNSENGSGGSGSGSTTLST 749
               ||:.:..:..||.|.||.||..:....|...|                              
  Rat   567 LEYPRNNIEYVRDIGEGAFGRVFQARAPGLLPYEP------------------------------ 601

  Fly   750 LNEKRRSKTSMDDIEEIKEEEQDQHNQSGLEQLVLVKALNKVKDEQACQEFRRQLDLLRAISHKG 814
                    .:|..::.:|||..                    .|.||  :|:|:..|:....:..
  Rat   602 --------FTMVAVKMLKEEAS--------------------ADMQA--DFQREAALMAEFDNPN 636

  Fly   815 VVRLFGLCREKDPHYMVLEYTDWGDLKQFL---------------LATAGKVNTATAGSSSPPPL 864
            :|:|.|:|....|..::.||..:|||.:||               |:|..:|:     |..||||
  Rat   637 IVKLLGVCAVGKPMCLLFEYMAYGDLNEFLRSMSPHTVCSLSHSDLSTRARVS-----SPGPPPL 696

  Fly   865 TTSQVLAVAYQIARGMDAIYRARFTHRDLATRNCVISSEFIVKVSYPALCKDKYSREYHK-HRNT 928
            :.::.|.:|.|:|.||..:...:|.|||||||||::....:||::...|.::.||.:|:| ..|.
  Rat   697 SCAEQLCIARQVAAGMAYLSERKFVHRDLATRNCLVGENMVVKIADFGLSRNIYSADYYKADGND 761

  Fly   929 LLPIRWLAPECIQEDEYTTKSDIFAYGVVVWELFNQATKLPHEELTNEQVVQRSQAGSLEWSVAE 993
            .:||||:.||.|..:.|||:||::|||||:||:|:...: |:..:.:|:|:...:.|:: .:..|
  Rat   762 AIPIRWMPPESIFYNRYTTESDVWAYGVVLWEIFSYGLQ-PYYGMAHEEVIYYVRDGNI-LACPE 824

  Fly   994 ATPDSLREILLSCWVSNPKERPSFSQLGAALSKAMQSAE 1032
            ..|..|..::..||...|.:||||..:...|.:..:.||
  Rat   825 NCPLELYNLMRLCWSKLPADRPSFCSIHRILQRMCERAE 863

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otkNP_523705.2 I-set 26..115 CDD:254352 5/16 (31%)
Ig 31..115 CDD:299845 5/16 (31%)
IGc2 133..195 CDD:197706 23/68 (34%)
Ig 268..373 CDD:299845 23/111 (21%)
Ig 395..460 CDD:143165 18/70 (26%)
I-set 468..559 CDD:254352 21/167 (13%)
IGc2 484..549 CDD:197706 18/141 (13%)
PTK_CCK4 686..1026 CDD:133178 101/366 (28%)
STYKc 692..1020 CDD:214568 97/343 (28%)
MuskNP_112323.2 IgI_1_MuSK 28..117 CDD:409562 29/105 (28%)
Ig strand B 45..49 CDD:409562 0/9 (0%)
Ig strand C 58..62 CDD:409562 2/3 (67%)
Ig strand E 82..86 CDD:409562 3/7 (43%)
Ig strand F 96..101 CDD:409562 2/4 (50%)
Ig strand G 110..113 CDD:409562 0/2 (0%)
IgI_2_MuSK 122..209 CDD:409560 29/166 (17%)
Ig strand B 138..142 CDD:409560 1/3 (33%)
Ig strand C 151..155 CDD:409560 0/3 (0%)
Ig strand E 173..177 CDD:409560 2/3 (67%)
Ig strand F 187..192 CDD:409560 3/4 (75%)
Ig strand G 201..204 CDD:409560 0/2 (0%)
Ig_3 218..286 CDD:404760 19/73 (26%)
Ig strand A' 222..225 CDD:409353 1/2 (50%)
Ig strand B 229..236 CDD:409353 2/7 (29%)
Ig strand C 242..247 CDD:409353 1/4 (25%)
Ig strand C' 250..252 CDD:409353 0/1 (0%)
Ig strand D 258..262 CDD:409353 0/3 (0%)
Ig strand E 268..272 CDD:409353 0/3 (0%)
Ig strand F 278..286 CDD:409353 5/7 (71%)
CRD_TK_ROR_related 313..457 CDD:143578 18/146 (12%)
PTKc_Musk 568..857 CDD:133181 100/355 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1026
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.